Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6Q213

Protein Details
Accession B6Q213    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
36-59GHSRWSTIKHDKAKNDKAKSKERGBasic
NLS Segment(s)
Subcellular Location(s) mito 15, cyto_mito 12.333, cyto 7.5, cyto_nucl 6.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR017856  Integrase-like_N  
IPR002876  Transcrip_reg_TACO1-like  
IPR026564  Transcrip_reg_TACO1-like_dom3  
IPR029072  YebC-like  
KEGG tmf:PMAA_018090  -  
Pfam View protein in Pfam  
PF01709  Transcrip_reg  
Amino Acid Sequences MASAFGLRFTCRSGLNTRWVCDTCRSFHVSATTQSGHSRWSTIKHDKAKNDKAKSKERGILTQELINASQLWGPDPKNNPRLQLAIAKAKQSQMPKAIIDNAIARGQGVSLSGQALESVTIEAMLPGTVAAVIECMAENKARILQDVRFTIKDNGGTVTPTTYLFEKKGRLVFENKEGTNPDDYLDQAIEAGATDIDTDTEGRLVVYTEPTATKSVGEALSQATSLVIAQSQIIWDPNKDTMVKVEDPEQLNQLEEVLAALREESSVQDIFLNTNV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.4
3 0.44
4 0.43
5 0.47
6 0.47
7 0.46
8 0.47
9 0.47
10 0.4
11 0.41
12 0.45
13 0.39
14 0.4
15 0.43
16 0.38
17 0.36
18 0.38
19 0.35
20 0.3
21 0.32
22 0.3
23 0.26
24 0.24
25 0.24
26 0.2
27 0.24
28 0.32
29 0.39
30 0.48
31 0.55
32 0.61
33 0.67
34 0.75
35 0.8
36 0.81
37 0.81
38 0.79
39 0.77
40 0.8
41 0.78
42 0.75
43 0.71
44 0.65
45 0.63
46 0.6
47 0.58
48 0.5
49 0.45
50 0.39
51 0.33
52 0.3
53 0.23
54 0.18
55 0.13
56 0.12
57 0.1
58 0.1
59 0.12
60 0.14
61 0.19
62 0.25
63 0.33
64 0.39
65 0.41
66 0.42
67 0.41
68 0.42
69 0.38
70 0.38
71 0.34
72 0.36
73 0.36
74 0.35
75 0.34
76 0.34
77 0.35
78 0.32
79 0.32
80 0.28
81 0.29
82 0.27
83 0.27
84 0.28
85 0.25
86 0.23
87 0.2
88 0.17
89 0.15
90 0.14
91 0.12
92 0.1
93 0.09
94 0.07
95 0.07
96 0.05
97 0.04
98 0.05
99 0.05
100 0.05
101 0.05
102 0.05
103 0.04
104 0.04
105 0.04
106 0.03
107 0.03
108 0.03
109 0.03
110 0.03
111 0.03
112 0.03
113 0.02
114 0.02
115 0.02
116 0.02
117 0.02
118 0.02
119 0.03
120 0.03
121 0.03
122 0.03
123 0.04
124 0.04
125 0.05
126 0.05
127 0.07
128 0.07
129 0.08
130 0.1
131 0.11
132 0.15
133 0.18
134 0.2
135 0.18
136 0.21
137 0.22
138 0.21
139 0.2
140 0.17
141 0.15
142 0.13
143 0.13
144 0.11
145 0.1
146 0.09
147 0.08
148 0.09
149 0.09
150 0.1
151 0.12
152 0.14
153 0.16
154 0.19
155 0.22
156 0.23
157 0.25
158 0.28
159 0.29
160 0.34
161 0.38
162 0.34
163 0.33
164 0.33
165 0.31
166 0.29
167 0.26
168 0.19
169 0.14
170 0.14
171 0.13
172 0.11
173 0.09
174 0.07
175 0.06
176 0.05
177 0.05
178 0.05
179 0.03
180 0.03
181 0.03
182 0.03
183 0.04
184 0.04
185 0.05
186 0.05
187 0.05
188 0.05
189 0.05
190 0.05
191 0.06
192 0.06
193 0.08
194 0.08
195 0.09
196 0.1
197 0.12
198 0.13
199 0.12
200 0.12
201 0.1
202 0.14
203 0.13
204 0.13
205 0.12
206 0.12
207 0.12
208 0.12
209 0.11
210 0.07
211 0.07
212 0.07
213 0.06
214 0.05
215 0.04
216 0.05
217 0.05
218 0.06
219 0.07
220 0.1
221 0.11
222 0.12
223 0.14
224 0.17
225 0.19
226 0.2
227 0.19
228 0.21
229 0.25
230 0.26
231 0.25
232 0.28
233 0.31
234 0.33
235 0.34
236 0.32
237 0.27
238 0.26
239 0.24
240 0.2
241 0.14
242 0.11
243 0.09
244 0.07
245 0.07
246 0.06
247 0.06
248 0.06
249 0.06
250 0.07
251 0.08
252 0.11
253 0.11
254 0.11
255 0.13
256 0.13