Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067MK41

Protein Details
Accession A0A067MK41    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MSSKRGRKRNDNLPPNRARDHydrophilic
NLS Segment(s)
PositionSequence
7-8RK
Subcellular Location(s) nucl 19, cyto 5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
Amino Acid Sequences MSSKRGRKRNDNLPPNRARDVQRAFRARRAAHLEALECRVQLLEDENNRLREALNLPPSDRPPLGTGPTGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.79
3 0.74
4 0.68
5 0.61
6 0.59
7 0.58
8 0.57
9 0.58
10 0.61
11 0.59
12 0.6
13 0.62
14 0.53
15 0.52
16 0.51
17 0.44
18 0.39
19 0.37
20 0.33
21 0.27
22 0.29
23 0.23
24 0.15
25 0.13
26 0.1
27 0.09
28 0.08
29 0.09
30 0.12
31 0.13
32 0.19
33 0.22
34 0.24
35 0.24
36 0.24
37 0.21
38 0.2
39 0.21
40 0.23
41 0.27
42 0.27
43 0.29
44 0.33
45 0.35
46 0.37
47 0.35
48 0.3
49 0.26
50 0.29
51 0.31