Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067MAU4

Protein Details
Accession A0A067MAU4    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-44MAVKIVKKRTKPFKRHQSDRYHSVKEAWRKPKGIDNRVRRRFKGBasic
NLS Segment(s)
PositionSequence
7-45KKRTKPFKRHQSDRYHSVKEAWRKPKGIDNRVRRRFKGQ
Subcellular Location(s) nucl 14.5, mito_nucl 11, mito 6.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAVKIVKKRTKPFKRHQSDRYHSVKEAWRKPKGIDNRVRRRFKGQLPMPKIGYGSDKRTRHLLPNGLKKFLVYNVKEVDILLMHNKSFTAEIAHGVSSRNRITILERAKALGVKVTNAHARLRTEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.92
3 0.91
4 0.91
5 0.88
6 0.86
7 0.83
8 0.76
9 0.66
10 0.63
11 0.61
12 0.6
13 0.61
14 0.61
15 0.6
16 0.58
17 0.59
18 0.61
19 0.64
20 0.64
21 0.64
22 0.66
23 0.71
24 0.79
25 0.83
26 0.76
27 0.74
28 0.71
29 0.68
30 0.68
31 0.64
32 0.64
33 0.64
34 0.66
35 0.59
36 0.52
37 0.46
38 0.36
39 0.34
40 0.27
41 0.28
42 0.32
43 0.32
44 0.32
45 0.37
46 0.37
47 0.37
48 0.39
49 0.39
50 0.38
51 0.48
52 0.48
53 0.45
54 0.44
55 0.38
56 0.34
57 0.31
58 0.32
59 0.22
60 0.24
61 0.24
62 0.25
63 0.25
64 0.24
65 0.2
66 0.12
67 0.12
68 0.1
69 0.1
70 0.09
71 0.09
72 0.09
73 0.09
74 0.09
75 0.09
76 0.09
77 0.09
78 0.11
79 0.12
80 0.12
81 0.12
82 0.13
83 0.14
84 0.16
85 0.16
86 0.15
87 0.15
88 0.15
89 0.19
90 0.26
91 0.3
92 0.3
93 0.29
94 0.3
95 0.31
96 0.31
97 0.28
98 0.25
99 0.2
100 0.18
101 0.2
102 0.24
103 0.27
104 0.28
105 0.32
106 0.31