Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6QKR1

Protein Details
Accession B6QKR1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
274-293HGSPASKKNRHDNDDKDKDHBasic
NLS Segment(s)
Subcellular Location(s) plas 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR006977  Yip1_dom  
IPR039765  Yip5/YIPF1/YIPF2  
Gene Ontology GO:0000139  C:Golgi membrane  
GO:0031267  F:small GTPase binding  
GO:0016192  P:vesicle-mediated transport  
KEGG tmf:PMAA_054840  -  
Pfam View protein in Pfam  
PF04893  Yip1  
Amino Acid Sequences MANQGYDVVVDVDAEGDLGHTDLQEDLEFHPSNFENDPRSAKIQADSQPFLGSDSGPSRSGGGGGISSGNVGGKHHLWTIQYYSQFFDVDTNEVVRRCVAAVYPRSNFLDVLDGNPDLYGPFWIATTVVIILFLTGTISQYLAHEHDEHFEYDFRLLSGAAGLIYGYTGVIPIALWGALRWFGSSSADLIECWALYGYANLLWIAVALASWSPLTALNWALVGVGFAWTVFFLLRNLYPVLSATDAKTSKILLILVVVLHAGLAIAIKVLFFAHGSPASKKNRHDNDDKDKDHDDRRMFF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.04
4 0.04
5 0.05
6 0.05
7 0.04
8 0.05
9 0.06
10 0.07
11 0.07
12 0.09
13 0.1
14 0.16
15 0.17
16 0.16
17 0.2
18 0.2
19 0.22
20 0.24
21 0.26
22 0.23
23 0.27
24 0.31
25 0.31
26 0.34
27 0.33
28 0.32
29 0.31
30 0.34
31 0.37
32 0.4
33 0.38
34 0.35
35 0.34
36 0.32
37 0.31
38 0.25
39 0.18
40 0.14
41 0.16
42 0.17
43 0.17
44 0.17
45 0.17
46 0.16
47 0.16
48 0.13
49 0.11
50 0.08
51 0.08
52 0.08
53 0.07
54 0.06
55 0.06
56 0.07
57 0.06
58 0.07
59 0.09
60 0.09
61 0.11
62 0.12
63 0.14
64 0.14
65 0.16
66 0.21
67 0.23
68 0.25
69 0.24
70 0.24
71 0.24
72 0.23
73 0.2
74 0.17
75 0.14
76 0.13
77 0.13
78 0.13
79 0.14
80 0.14
81 0.14
82 0.12
83 0.12
84 0.1
85 0.1
86 0.1
87 0.14
88 0.2
89 0.25
90 0.26
91 0.28
92 0.29
93 0.29
94 0.28
95 0.21
96 0.2
97 0.15
98 0.15
99 0.14
100 0.13
101 0.12
102 0.12
103 0.11
104 0.06
105 0.06
106 0.05
107 0.04
108 0.04
109 0.04
110 0.05
111 0.05
112 0.05
113 0.05
114 0.05
115 0.04
116 0.04
117 0.04
118 0.03
119 0.03
120 0.03
121 0.03
122 0.03
123 0.03
124 0.03
125 0.04
126 0.04
127 0.04
128 0.06
129 0.06
130 0.08
131 0.08
132 0.08
133 0.1
134 0.11
135 0.11
136 0.11
137 0.11
138 0.1
139 0.1
140 0.1
141 0.08
142 0.07
143 0.06
144 0.05
145 0.05
146 0.04
147 0.03
148 0.03
149 0.03
150 0.02
151 0.02
152 0.02
153 0.02
154 0.02
155 0.02
156 0.02
157 0.02
158 0.02
159 0.02
160 0.03
161 0.03
162 0.03
163 0.03
164 0.03
165 0.04
166 0.05
167 0.05
168 0.05
169 0.06
170 0.08
171 0.08
172 0.08
173 0.08
174 0.08
175 0.08
176 0.08
177 0.08
178 0.06
179 0.06
180 0.05
181 0.04
182 0.04
183 0.05
184 0.04
185 0.04
186 0.05
187 0.05
188 0.05
189 0.04
190 0.04
191 0.04
192 0.03
193 0.03
194 0.03
195 0.03
196 0.03
197 0.03
198 0.03
199 0.04
200 0.05
201 0.06
202 0.07
203 0.07
204 0.07
205 0.07
206 0.07
207 0.07
208 0.06
209 0.06
210 0.04
211 0.04
212 0.04
213 0.04
214 0.04
215 0.04
216 0.04
217 0.04
218 0.05
219 0.05
220 0.07
221 0.08
222 0.1
223 0.11
224 0.11
225 0.11
226 0.11
227 0.13
228 0.13
229 0.14
230 0.13
231 0.19
232 0.2
233 0.2
234 0.2
235 0.19
236 0.17
237 0.18
238 0.17
239 0.1
240 0.1
241 0.1
242 0.09
243 0.08
244 0.07
245 0.05
246 0.05
247 0.04
248 0.03
249 0.03
250 0.03
251 0.03
252 0.03
253 0.03
254 0.03
255 0.04
256 0.04
257 0.05
258 0.05
259 0.06
260 0.1
261 0.14
262 0.17
263 0.21
264 0.3
265 0.39
266 0.45
267 0.5
268 0.57
269 0.63
270 0.68
271 0.73
272 0.75
273 0.77
274 0.81
275 0.78
276 0.72
277 0.68
278 0.67
279 0.65
280 0.63