Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067MDC3

Protein Details
Accession A0A067MDC3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
57-76RRPSVKSRKHWLRSVLCRGKBasic
NLS Segment(s)
Subcellular Location(s) mito 22.5, cyto_mito 13, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MRLAVFQSLNALLTLLIGRRFARNITGLCTCMQAIELFHSSVSDSLEKGVVFAGVDRRPSVKSRKHWLRSVLCRGKVLGRGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.08
4 0.1
5 0.11
6 0.13
7 0.14
8 0.14
9 0.16
10 0.19
11 0.19
12 0.21
13 0.22
14 0.21
15 0.21
16 0.21
17 0.18
18 0.13
19 0.13
20 0.09
21 0.08
22 0.09
23 0.1
24 0.09
25 0.09
26 0.09
27 0.08
28 0.08
29 0.09
30 0.07
31 0.06
32 0.06
33 0.08
34 0.07
35 0.07
36 0.07
37 0.06
38 0.05
39 0.06
40 0.11
41 0.11
42 0.13
43 0.13
44 0.15
45 0.17
46 0.22
47 0.3
48 0.34
49 0.41
50 0.51
51 0.62
52 0.67
53 0.72
54 0.77
55 0.78
56 0.79
57 0.81
58 0.8
59 0.72
60 0.67
61 0.62
62 0.58