Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067MW40

Protein Details
Accession A0A067MW40   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
222-248TGIFNSRPSRHSPKRRAKVPKAASSKAHydrophilic
NLS Segment(s)
PositionSequence
229-247PSRHSPKRRAKVPKAASSK
Subcellular Location(s) nucl 9, cyto 7, mito_nucl 7, mito 5
Family & Domain DBs
Amino Acid Sequences AKAPLSAAFKPLSPIAPEAQASGLAVIEHINRVLAPSHFQLKGCAWSPFSNFIATPHSPEDVDRLPGILPRILQDMFKVPFSHLTFDLSSLVVVYNLPLGPAGNWSDPSAMALALMAQNNITEPLPASPGRWLANPDRHKGATASLRLSLSPQAKAAILKSGSLFFEGRPHPRRGAVGSPQSAAPAARITPPITILRSRPTRPTTASSAKALTPPGHAGALTGIFNSRPSRHSPKRRAKVPKAASSKAAPSGAGAPSINVSGSSVTDPAGNVTTHL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.21
3 0.24
4 0.24
5 0.22
6 0.2
7 0.18
8 0.16
9 0.13
10 0.11
11 0.07
12 0.07
13 0.07
14 0.08
15 0.08
16 0.08
17 0.08
18 0.07
19 0.09
20 0.11
21 0.11
22 0.14
23 0.17
24 0.22
25 0.24
26 0.25
27 0.27
28 0.26
29 0.31
30 0.3
31 0.29
32 0.26
33 0.28
34 0.31
35 0.33
36 0.31
37 0.27
38 0.25
39 0.24
40 0.28
41 0.25
42 0.25
43 0.22
44 0.22
45 0.21
46 0.21
47 0.24
48 0.2
49 0.21
50 0.17
51 0.16
52 0.15
53 0.17
54 0.18
55 0.14
56 0.13
57 0.12
58 0.15
59 0.15
60 0.15
61 0.14
62 0.18
63 0.18
64 0.2
65 0.19
66 0.17
67 0.23
68 0.25
69 0.26
70 0.21
71 0.23
72 0.21
73 0.21
74 0.21
75 0.14
76 0.13
77 0.1
78 0.09
79 0.06
80 0.06
81 0.05
82 0.05
83 0.05
84 0.05
85 0.05
86 0.05
87 0.05
88 0.07
89 0.09
90 0.08
91 0.09
92 0.1
93 0.11
94 0.1
95 0.11
96 0.09
97 0.07
98 0.06
99 0.05
100 0.05
101 0.06
102 0.06
103 0.05
104 0.05
105 0.05
106 0.05
107 0.06
108 0.06
109 0.04
110 0.05
111 0.05
112 0.08
113 0.08
114 0.09
115 0.09
116 0.12
117 0.12
118 0.13
119 0.15
120 0.18
121 0.27
122 0.3
123 0.31
124 0.32
125 0.32
126 0.32
127 0.29
128 0.28
129 0.24
130 0.22
131 0.21
132 0.19
133 0.19
134 0.19
135 0.19
136 0.2
137 0.17
138 0.15
139 0.14
140 0.13
141 0.14
142 0.14
143 0.14
144 0.13
145 0.12
146 0.12
147 0.12
148 0.12
149 0.12
150 0.13
151 0.13
152 0.09
153 0.15
154 0.17
155 0.25
156 0.29
157 0.31
158 0.31
159 0.32
160 0.34
161 0.31
162 0.35
163 0.34
164 0.35
165 0.34
166 0.33
167 0.32
168 0.3
169 0.27
170 0.21
171 0.14
172 0.09
173 0.08
174 0.09
175 0.11
176 0.12
177 0.12
178 0.14
179 0.16
180 0.17
181 0.19
182 0.19
183 0.26
184 0.31
185 0.33
186 0.39
187 0.4
188 0.43
189 0.44
190 0.47
191 0.47
192 0.47
193 0.48
194 0.43
195 0.41
196 0.37
197 0.35
198 0.32
199 0.25
200 0.21
201 0.2
202 0.19
203 0.17
204 0.16
205 0.14
206 0.13
207 0.13
208 0.11
209 0.09
210 0.08
211 0.08
212 0.11
213 0.14
214 0.15
215 0.16
216 0.24
217 0.35
218 0.45
219 0.56
220 0.64
221 0.72
222 0.8
223 0.88
224 0.91
225 0.9
226 0.9
227 0.89
228 0.88
229 0.85
230 0.78
231 0.73
232 0.65
233 0.6
234 0.54
235 0.45
236 0.35
237 0.28
238 0.29
239 0.25
240 0.23
241 0.19
242 0.15
243 0.15
244 0.16
245 0.14
246 0.1
247 0.1
248 0.09
249 0.1
250 0.11
251 0.1
252 0.1
253 0.11
254 0.11
255 0.13
256 0.14