Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067M5G3

Protein Details
Accession A0A067M5G3    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
280-301ASQPPSKKTKHGRKPATKPIKSHydrophilic
NLS Segment(s)
PositionSequence
285-298SKKTKHGRKPATKP
Subcellular Location(s) nucl 13.5, cyto_nucl 10, cyto 5.5, mito 4, plas 2, extr 2
Family & Domain DBs
Amino Acid Sequences MNRHNFSYATSTVPSTPTMPTVSFNDAPVFPSSPLSHADSTFGAFQYSQALPAFQQQPSLPAVRVKDMDHDALFNSGNHIYISLYHKNMILKNENAMLQATEERLHQSLQAFASQPAPAPPMNTTTSTNSCPVPTINYASLPKLEHAQFPKIHYWTFAQWAAHVKAEEERTQLQSNSNTVKHSGRSGRTQGENITMRYIEQENGQPWTNVDKEADKYYISEMYSSFPELRYCDDNWKAQKVAFQTYPGWIKQFKIKDEPLDVDSITDLDTPPKCAASPTASQPPSKKTKHGRKPATKPIKSIASIAAVAPQPLLPPVVFSSTPPTPSTDSLSLPPAPELSPPTTPRNVLVPLSQVNLDLDLDDDISPLPSPRLSSSGASSSSPASKENPTPTLASVVVAANNILPSSTNRKTPTPDTTATVPTPLAITSIVTNMATTNTPAMVNGTSNFANIVIDDPLADTYSPDAIPLPPRLALENVATSTTAAASSTVVSTKPHATSSSTKPCVGSKGLMVPVATGRGSTTPRNLYAWDYCKEHPDTTKEEFTKVWDNLATPERKKYTDLSKAAKKDK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.22
3 0.22
4 0.2
5 0.22
6 0.21
7 0.22
8 0.25
9 0.3
10 0.29
11 0.29
12 0.3
13 0.27
14 0.29
15 0.29
16 0.27
17 0.2
18 0.23
19 0.23
20 0.22
21 0.25
22 0.27
23 0.26
24 0.24
25 0.26
26 0.22
27 0.23
28 0.23
29 0.2
30 0.16
31 0.14
32 0.14
33 0.17
34 0.16
35 0.17
36 0.15
37 0.16
38 0.15
39 0.23
40 0.27
41 0.22
42 0.26
43 0.23
44 0.26
45 0.28
46 0.3
47 0.24
48 0.24
49 0.26
50 0.27
51 0.29
52 0.28
53 0.31
54 0.32
55 0.34
56 0.3
57 0.29
58 0.24
59 0.24
60 0.24
61 0.18
62 0.17
63 0.14
64 0.14
65 0.13
66 0.12
67 0.1
68 0.14
69 0.2
70 0.22
71 0.23
72 0.24
73 0.27
74 0.31
75 0.34
76 0.37
77 0.36
78 0.32
79 0.34
80 0.36
81 0.34
82 0.3
83 0.27
84 0.21
85 0.17
86 0.17
87 0.15
88 0.13
89 0.13
90 0.15
91 0.15
92 0.15
93 0.15
94 0.15
95 0.17
96 0.17
97 0.2
98 0.18
99 0.18
100 0.2
101 0.18
102 0.18
103 0.16
104 0.17
105 0.15
106 0.15
107 0.15
108 0.17
109 0.19
110 0.21
111 0.23
112 0.25
113 0.29
114 0.3
115 0.31
116 0.27
117 0.25
118 0.24
119 0.22
120 0.21
121 0.2
122 0.22
123 0.21
124 0.24
125 0.25
126 0.25
127 0.26
128 0.23
129 0.21
130 0.23
131 0.23
132 0.24
133 0.27
134 0.32
135 0.33
136 0.36
137 0.41
138 0.37
139 0.36
140 0.32
141 0.31
142 0.27
143 0.29
144 0.28
145 0.22
146 0.22
147 0.28
148 0.27
149 0.26
150 0.23
151 0.2
152 0.21
153 0.24
154 0.24
155 0.21
156 0.22
157 0.24
158 0.26
159 0.26
160 0.26
161 0.25
162 0.27
163 0.29
164 0.28
165 0.26
166 0.26
167 0.28
168 0.25
169 0.29
170 0.32
171 0.31
172 0.35
173 0.39
174 0.42
175 0.42
176 0.42
177 0.37
178 0.38
179 0.37
180 0.31
181 0.28
182 0.23
183 0.2
184 0.21
185 0.21
186 0.14
187 0.13
188 0.16
189 0.15
190 0.18
191 0.19
192 0.16
193 0.16
194 0.19
195 0.18
196 0.15
197 0.15
198 0.15
199 0.17
200 0.19
201 0.2
202 0.16
203 0.16
204 0.16
205 0.17
206 0.15
207 0.13
208 0.11
209 0.12
210 0.13
211 0.13
212 0.12
213 0.11
214 0.12
215 0.12
216 0.14
217 0.16
218 0.16
219 0.22
220 0.24
221 0.3
222 0.32
223 0.34
224 0.31
225 0.29
226 0.31
227 0.27
228 0.28
229 0.23
230 0.23
231 0.21
232 0.23
233 0.26
234 0.23
235 0.22
236 0.18
237 0.19
238 0.23
239 0.26
240 0.26
241 0.29
242 0.31
243 0.31
244 0.33
245 0.34
246 0.28
247 0.25
248 0.22
249 0.16
250 0.14
251 0.11
252 0.09
253 0.07
254 0.06
255 0.08
256 0.08
257 0.1
258 0.11
259 0.11
260 0.1
261 0.1
262 0.12
263 0.13
264 0.15
265 0.17
266 0.25
267 0.26
268 0.28
269 0.3
270 0.34
271 0.38
272 0.38
273 0.41
274 0.44
275 0.53
276 0.61
277 0.7
278 0.74
279 0.76
280 0.83
281 0.86
282 0.87
283 0.78
284 0.71
285 0.65
286 0.59
287 0.5
288 0.42
289 0.33
290 0.23
291 0.21
292 0.19
293 0.18
294 0.12
295 0.12
296 0.1
297 0.09
298 0.07
299 0.07
300 0.08
301 0.04
302 0.05
303 0.06
304 0.09
305 0.09
306 0.09
307 0.14
308 0.14
309 0.17
310 0.16
311 0.18
312 0.17
313 0.19
314 0.22
315 0.19
316 0.19
317 0.19
318 0.21
319 0.2
320 0.18
321 0.17
322 0.14
323 0.12
324 0.12
325 0.14
326 0.14
327 0.17
328 0.2
329 0.25
330 0.25
331 0.25
332 0.25
333 0.26
334 0.25
335 0.21
336 0.19
337 0.17
338 0.17
339 0.17
340 0.17
341 0.13
342 0.12
343 0.11
344 0.1
345 0.07
346 0.06
347 0.05
348 0.06
349 0.06
350 0.06
351 0.05
352 0.06
353 0.06
354 0.06
355 0.06
356 0.06
357 0.07
358 0.08
359 0.11
360 0.13
361 0.14
362 0.16
363 0.19
364 0.19
365 0.19
366 0.18
367 0.17
368 0.17
369 0.17
370 0.16
371 0.16
372 0.18
373 0.22
374 0.26
375 0.27
376 0.26
377 0.27
378 0.26
379 0.26
380 0.22
381 0.18
382 0.15
383 0.13
384 0.11
385 0.1
386 0.1
387 0.07
388 0.07
389 0.06
390 0.05
391 0.05
392 0.08
393 0.16
394 0.19
395 0.24
396 0.27
397 0.3
398 0.36
399 0.4
400 0.45
401 0.43
402 0.43
403 0.4
404 0.41
405 0.42
406 0.37
407 0.33
408 0.25
409 0.19
410 0.17
411 0.14
412 0.11
413 0.07
414 0.07
415 0.07
416 0.08
417 0.08
418 0.08
419 0.08
420 0.07
421 0.09
422 0.08
423 0.08
424 0.08
425 0.08
426 0.08
427 0.08
428 0.1
429 0.09
430 0.1
431 0.1
432 0.13
433 0.12
434 0.12
435 0.12
436 0.1
437 0.1
438 0.09
439 0.09
440 0.07
441 0.07
442 0.07
443 0.07
444 0.07
445 0.08
446 0.08
447 0.07
448 0.07
449 0.09
450 0.09
451 0.09
452 0.1
453 0.11
454 0.15
455 0.18
456 0.18
457 0.18
458 0.19
459 0.2
460 0.21
461 0.21
462 0.19
463 0.19
464 0.18
465 0.17
466 0.17
467 0.15
468 0.14
469 0.12
470 0.09
471 0.07
472 0.06
473 0.06
474 0.07
475 0.08
476 0.08
477 0.09
478 0.1
479 0.13
480 0.17
481 0.19
482 0.2
483 0.2
484 0.25
485 0.31
486 0.4
487 0.47
488 0.46
489 0.46
490 0.46
491 0.47
492 0.46
493 0.43
494 0.36
495 0.28
496 0.31
497 0.32
498 0.32
499 0.29
500 0.26
501 0.24
502 0.24
503 0.2
504 0.13
505 0.13
506 0.15
507 0.19
508 0.21
509 0.27
510 0.3
511 0.32
512 0.34
513 0.34
514 0.36
515 0.4
516 0.42
517 0.39
518 0.39
519 0.38
520 0.43
521 0.46
522 0.45
523 0.43
524 0.43
525 0.46
526 0.48
527 0.56
528 0.51
529 0.49
530 0.45
531 0.44
532 0.48
533 0.42
534 0.39
535 0.31
536 0.3
537 0.34
538 0.41
539 0.44
540 0.38
541 0.46
542 0.47
543 0.47
544 0.49
545 0.5
546 0.52
547 0.55
548 0.6
549 0.6
550 0.65