Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067MHB3

Protein Details
Accession A0A067MHB3   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
4-24RVTLRKRQPYNTTSNRRRMVKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, cyto 9, mito_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR008195  Ribosomal_L34Ae  
IPR018065  Ribosomal_L34e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01199  Ribosomal_L34e  
PROSITE View protein in PROSITE  
PS01145  RIBOSOMAL_L34E  
Amino Acid Sequences MAQRVTLRKRQPYNTTSNRRRMVKTPGGKLVYHHLKKLPTAPKCGDCGTALPGVPALRPRQYATISRRQKTVQRAYGGSRCGECVKLRVMRAFLVEEAKIVKKVIKSQTKGSKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.8
3 0.79
4 0.81
5 0.8
6 0.76
7 0.74
8 0.69
9 0.68
10 0.67
11 0.66
12 0.63
13 0.63
14 0.61
15 0.56
16 0.52
17 0.52
18 0.52
19 0.46
20 0.42
21 0.38
22 0.37
23 0.38
24 0.45
25 0.44
26 0.37
27 0.42
28 0.43
29 0.42
30 0.43
31 0.42
32 0.35
33 0.27
34 0.25
35 0.2
36 0.18
37 0.15
38 0.12
39 0.12
40 0.1
41 0.1
42 0.11
43 0.11
44 0.12
45 0.13
46 0.14
47 0.17
48 0.19
49 0.26
50 0.3
51 0.38
52 0.44
53 0.44
54 0.46
55 0.46
56 0.49
57 0.52
58 0.55
59 0.51
60 0.47
61 0.48
62 0.5
63 0.52
64 0.47
65 0.39
66 0.3
67 0.26
68 0.24
69 0.24
70 0.2
71 0.18
72 0.22
73 0.26
74 0.28
75 0.29
76 0.29
77 0.28
78 0.29
79 0.28
80 0.23
81 0.22
82 0.19
83 0.17
84 0.18
85 0.19
86 0.18
87 0.17
88 0.19
89 0.19
90 0.28
91 0.37
92 0.44
93 0.47
94 0.56