Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067M177

Protein Details
Accession A0A067M177    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
93-127LASKPDRASRKLRKERKNRAKKFRGTKKIKGSEAVBasic
NLS Segment(s)
PositionSequence
84-131PKHRLVRVGLASKPDRASRKLRKERKNRAKKFRGTKKIKGSEAVKKGK
Subcellular Location(s) mito 19, nucl 4, cyto 4, cyto_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences PITLRTRKFITNRLLQRRQMIIDVIHPNRANVSKADLSEKLAGLYKADKKLVVTFGLRTQFGGGRSTGFALIYDDEAAQKRFEPKHRLVRVGLASKPDRASRKLRKERKNRAKKFRGTKKIKGSEAVKKGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.7
3 0.71
4 0.66
5 0.6
6 0.52
7 0.44
8 0.34
9 0.34
10 0.38
11 0.33
12 0.35
13 0.33
14 0.31
15 0.32
16 0.33
17 0.28
18 0.2
19 0.24
20 0.21
21 0.22
22 0.26
23 0.23
24 0.24
25 0.25
26 0.24
27 0.19
28 0.19
29 0.17
30 0.14
31 0.19
32 0.21
33 0.21
34 0.22
35 0.21
36 0.2
37 0.23
38 0.24
39 0.21
40 0.17
41 0.15
42 0.18
43 0.2
44 0.19
45 0.16
46 0.16
47 0.15
48 0.15
49 0.15
50 0.11
51 0.1
52 0.1
53 0.11
54 0.1
55 0.08
56 0.07
57 0.06
58 0.06
59 0.06
60 0.06
61 0.06
62 0.07
63 0.08
64 0.09
65 0.08
66 0.09
67 0.15
68 0.19
69 0.26
70 0.32
71 0.39
72 0.49
73 0.53
74 0.55
75 0.5
76 0.52
77 0.51
78 0.48
79 0.42
80 0.38
81 0.35
82 0.35
83 0.36
84 0.36
85 0.34
86 0.35
87 0.43
88 0.48
89 0.58
90 0.66
91 0.74
92 0.78
93 0.85
94 0.92
95 0.93
96 0.94
97 0.93
98 0.93
99 0.94
100 0.93
101 0.93
102 0.93
103 0.93
104 0.9
105 0.9
106 0.9
107 0.88
108 0.82
109 0.79
110 0.75
111 0.74