Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067MLK0

Protein Details
Accession A0A067MLK0    Localization Confidence Low Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
60-87TYPVERCLRTPRRRRVCREPVRFKKLTGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 7.5, cyto_nucl 7.5, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MNSSVVTADSLCAPSCRRIAPFCPELASLPRMPRLEKLCRGASSAPPPVTHNVPVVIPVTYPVERCLRTPRRRRVCREPVRFKKLTGLESLLLAAAASDDDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.2
3 0.22
4 0.24
5 0.27
6 0.32
7 0.37
8 0.38
9 0.34
10 0.34
11 0.32
12 0.3
13 0.29
14 0.28
15 0.23
16 0.23
17 0.27
18 0.26
19 0.26
20 0.3
21 0.32
22 0.36
23 0.39
24 0.42
25 0.41
26 0.4
27 0.42
28 0.38
29 0.36
30 0.34
31 0.34
32 0.3
33 0.26
34 0.27
35 0.27
36 0.26
37 0.23
38 0.18
39 0.14
40 0.13
41 0.13
42 0.12
43 0.1
44 0.08
45 0.07
46 0.1
47 0.1
48 0.11
49 0.12
50 0.16
51 0.16
52 0.18
53 0.28
54 0.35
55 0.45
56 0.55
57 0.63
58 0.7
59 0.79
60 0.86
61 0.87
62 0.87
63 0.88
64 0.89
65 0.9
66 0.89
67 0.89
68 0.82
69 0.72
70 0.7
71 0.64
72 0.55
73 0.48
74 0.42
75 0.33
76 0.32
77 0.31
78 0.22
79 0.17
80 0.14
81 0.09
82 0.05