Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067N7M0

Protein Details
Accession A0A067N7M0    Localization Confidence High Confidence Score 17.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-32MPPKVTRKPAPTPTRKSAPSKRAAPKAPRSIDHydrophilic
265-289MPDPERWLKKRDRTRVQAGKKGRGRBasic
NLS Segment(s)
PositionSequence
7-29RKPAPTPTRKSAPSKRAAPKAPR
270-290RWLKKRDRTRVQAGKKGRGRK
325-336GGGGGKKGKKGR
Subcellular Location(s) nucl 12.5, mito 10, cyto_nucl 9, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR026270  SRP72  
IPR031545  SRP_TPR-like  
IPR011990  TPR-like_helical_dom_sf  
Gene Ontology GO:0005783  C:endoplasmic reticulum  
GO:1990904  C:ribonucleoprotein complex  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
Pfam View protein in Pfam  
PF17004  SRP_TPR_like  
Amino Acid Sequences MPPKVTRKPAPTPTRKSAPSKRAAPKAPRSIDDRLKRLFSSLSSQIDGSHFKNALKTCDKILRLSPVDEDALRTKLVLLLQLDQYGTALTLIDSLAASSSDPKAHSFGFERAYVLYRLHRESEADAALKELDTEEKGVMHLEAQLKYRQGEYEAARDIYNDILVNHSPDADEHHDIITNLSATQKHIEFLSQGYLTSVHALPVSIAALEAAGAPSLPPAQSAFSASAPASASASQPPKPVASDQTPKPPRKSRIPAHVVPGVTPMPDPERWLKKRDRTRVQAGKKGRGRKDHHNFGAGATQGSVADDRGTASGGGVVTNVNVKAGGGGGKKGKKGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.82
3 0.82
4 0.82
5 0.8
6 0.79
7 0.8
8 0.81
9 0.81
10 0.84
11 0.84
12 0.83
13 0.84
14 0.8
15 0.74
16 0.7
17 0.69
18 0.7
19 0.69
20 0.65
21 0.59
22 0.58
23 0.54
24 0.51
25 0.44
26 0.37
27 0.35
28 0.35
29 0.33
30 0.31
31 0.3
32 0.3
33 0.3
34 0.32
35 0.26
36 0.26
37 0.24
38 0.23
39 0.29
40 0.29
41 0.34
42 0.35
43 0.35
44 0.35
45 0.41
46 0.42
47 0.4
48 0.41
49 0.42
50 0.4
51 0.4
52 0.36
53 0.3
54 0.3
55 0.27
56 0.26
57 0.2
58 0.19
59 0.18
60 0.16
61 0.14
62 0.14
63 0.15
64 0.15
65 0.13
66 0.15
67 0.16
68 0.17
69 0.16
70 0.14
71 0.13
72 0.1
73 0.09
74 0.06
75 0.05
76 0.04
77 0.04
78 0.04
79 0.04
80 0.04
81 0.04
82 0.04
83 0.04
84 0.05
85 0.06
86 0.08
87 0.09
88 0.1
89 0.11
90 0.13
91 0.13
92 0.16
93 0.17
94 0.19
95 0.2
96 0.2
97 0.19
98 0.18
99 0.2
100 0.19
101 0.17
102 0.17
103 0.18
104 0.19
105 0.21
106 0.2
107 0.19
108 0.19
109 0.21
110 0.19
111 0.16
112 0.14
113 0.12
114 0.12
115 0.11
116 0.09
117 0.07
118 0.06
119 0.06
120 0.07
121 0.06
122 0.06
123 0.07
124 0.07
125 0.07
126 0.06
127 0.09
128 0.11
129 0.13
130 0.15
131 0.16
132 0.17
133 0.18
134 0.18
135 0.15
136 0.13
137 0.17
138 0.16
139 0.18
140 0.19
141 0.19
142 0.19
143 0.18
144 0.17
145 0.12
146 0.11
147 0.08
148 0.06
149 0.07
150 0.07
151 0.08
152 0.08
153 0.07
154 0.07
155 0.06
156 0.1
157 0.12
158 0.13
159 0.12
160 0.13
161 0.13
162 0.13
163 0.14
164 0.1
165 0.07
166 0.06
167 0.07
168 0.07
169 0.08
170 0.1
171 0.1
172 0.1
173 0.09
174 0.1
175 0.09
176 0.09
177 0.11
178 0.09
179 0.09
180 0.09
181 0.09
182 0.09
183 0.11
184 0.1
185 0.07
186 0.07
187 0.07
188 0.07
189 0.07
190 0.07
191 0.04
192 0.04
193 0.03
194 0.03
195 0.03
196 0.03
197 0.03
198 0.03
199 0.03
200 0.03
201 0.03
202 0.04
203 0.04
204 0.04
205 0.05
206 0.06
207 0.07
208 0.09
209 0.1
210 0.1
211 0.12
212 0.11
213 0.12
214 0.11
215 0.11
216 0.1
217 0.09
218 0.1
219 0.14
220 0.17
221 0.17
222 0.19
223 0.2
224 0.2
225 0.21
226 0.23
227 0.23
228 0.27
229 0.33
230 0.35
231 0.44
232 0.52
233 0.55
234 0.61
235 0.65
236 0.65
237 0.68
238 0.74
239 0.72
240 0.74
241 0.77
242 0.72
243 0.68
244 0.66
245 0.55
246 0.46
247 0.41
248 0.31
249 0.23
250 0.19
251 0.16
252 0.15
253 0.16
254 0.19
255 0.24
256 0.34
257 0.37
258 0.45
259 0.52
260 0.58
261 0.68
262 0.75
263 0.77
264 0.75
265 0.83
266 0.86
267 0.86
268 0.85
269 0.82
270 0.82
271 0.79
272 0.8
273 0.76
274 0.76
275 0.74
276 0.76
277 0.79
278 0.79
279 0.76
280 0.71
281 0.64
282 0.56
283 0.55
284 0.44
285 0.34
286 0.23
287 0.19
288 0.14
289 0.15
290 0.13
291 0.08
292 0.08
293 0.08
294 0.09
295 0.09
296 0.1
297 0.08
298 0.08
299 0.1
300 0.09
301 0.09
302 0.08
303 0.08
304 0.08
305 0.11
306 0.11
307 0.09
308 0.09
309 0.09
310 0.09
311 0.1
312 0.15
313 0.13
314 0.18
315 0.26
316 0.31