Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067MH12

Protein Details
Accession A0A067MH12   
Localization Confidence High
Confidence Score 18.2
NoLS Segment(s)
PositionSequenceProtein Nature
27-58TTPPQPPRPRVPPPPPRRKRAHKRLSGPPRAKBasic
75-97NGAHRRSPPPRPRIQRTRPVAPEHydrophilic
NLS Segment(s)
PositionSequence
32-61PPRPRVPPPPPRRKRAHKRLSGPPRAKVKE
71-89PRASNGAHRRSPPPRPRIQ
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MQSPTPSQATSTPHAHNGAAPPIPLPTTPPQPPRPRVPPPPPRRKRAHKRLSGPPRAKVKELAVPCPATPPRASNGAHRRSPPPRPRIQRTRPVAPEILAALGLRTSSTSARSPLPMPRYT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.34
3 0.32
4 0.3
5 0.29
6 0.24
7 0.22
8 0.18
9 0.17
10 0.18
11 0.16
12 0.17
13 0.17
14 0.23
15 0.29
16 0.36
17 0.44
18 0.52
19 0.58
20 0.61
21 0.65
22 0.66
23 0.7
24 0.73
25 0.75
26 0.77
27 0.83
28 0.83
29 0.82
30 0.84
31 0.85
32 0.86
33 0.86
34 0.86
35 0.83
36 0.83
37 0.86
38 0.87
39 0.86
40 0.79
41 0.74
42 0.73
43 0.66
44 0.6
45 0.52
46 0.43
47 0.39
48 0.37
49 0.33
50 0.26
51 0.25
52 0.23
53 0.26
54 0.24
55 0.2
56 0.19
57 0.17
58 0.17
59 0.21
60 0.22
61 0.27
62 0.36
63 0.41
64 0.43
65 0.45
66 0.5
67 0.51
68 0.61
69 0.6
70 0.6
71 0.63
72 0.69
73 0.76
74 0.8
75 0.82
76 0.82
77 0.8
78 0.81
79 0.75
80 0.71
81 0.63
82 0.53
83 0.45
84 0.36
85 0.29
86 0.19
87 0.15
88 0.1
89 0.08
90 0.07
91 0.06
92 0.06
93 0.07
94 0.08
95 0.12
96 0.14
97 0.17
98 0.2
99 0.23
100 0.25
101 0.32