Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067MV26

Protein Details
Accession A0A067MV26    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
94-122RIAPRAHKPRDLERRRRRIRAPPIPPSATBasic
NLS Segment(s)
PositionSequence
77-116RPHPVLPRAPNMHAMRRRIAPRAHKPRDLERRRRRIRAPP
Subcellular Location(s) mito 21, nucl 5
Family & Domain DBs
Amino Acid Sequences MLLRRLVLVFHRHPTSPTTTAARFETRHRMGEIAAPSPVVPPIPSSSIPRTVSAPTPPIVPPPAPTTSPEQARPAPRPHPVLPRAPNMHAMRRRIAPRAHKPRDLERRRRRIRAPPIPPSATAVI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.35
4 0.35
5 0.34
6 0.32
7 0.35
8 0.37
9 0.37
10 0.32
11 0.34
12 0.4
13 0.38
14 0.39
15 0.37
16 0.34
17 0.3
18 0.34
19 0.31
20 0.22
21 0.19
22 0.16
23 0.15
24 0.15
25 0.14
26 0.09
27 0.07
28 0.07
29 0.09
30 0.12
31 0.13
32 0.17
33 0.2
34 0.27
35 0.28
36 0.27
37 0.27
38 0.25
39 0.26
40 0.24
41 0.23
42 0.16
43 0.17
44 0.16
45 0.16
46 0.16
47 0.14
48 0.14
49 0.16
50 0.17
51 0.16
52 0.17
53 0.21
54 0.24
55 0.26
56 0.26
57 0.26
58 0.28
59 0.32
60 0.35
61 0.35
62 0.35
63 0.37
64 0.41
65 0.42
66 0.47
67 0.46
68 0.5
69 0.49
70 0.53
71 0.52
72 0.48
73 0.52
74 0.46
75 0.52
76 0.49
77 0.48
78 0.44
79 0.47
80 0.49
81 0.46
82 0.5
83 0.52
84 0.57
85 0.65
86 0.68
87 0.68
88 0.7
89 0.74
90 0.78
91 0.79
92 0.79
93 0.78
94 0.83
95 0.86
96 0.9
97 0.87
98 0.87
99 0.87
100 0.87
101 0.86
102 0.84
103 0.83
104 0.78
105 0.7