Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067MNK1

Protein Details
Accession A0A067MNK1    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
92-111RPLARRARSMFRRRLRHWLPBasic
NLS Segment(s)
PositionSequence
95-107ARRARSMFRRRLR
Subcellular Location(s) nucl 10, mito 8, cyto 4, extr 3
Family & Domain DBs
Amino Acid Sequences MSSSAFIFSSPVDVFTVARPVEKAKAGAAPCTPPRAPTSRVPPARPRVQRTIHYAHPGEVQALAALPCFSRASASASAPSTPPLLFVLARLRPLARRARSMFRRRLRHWLPARPAPLNSPVLASPTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.19
4 0.15
5 0.16
6 0.16
7 0.18
8 0.21
9 0.22
10 0.21
11 0.17
12 0.23
13 0.23
14 0.25
15 0.24
16 0.26
17 0.26
18 0.31
19 0.29
20 0.25
21 0.29
22 0.31
23 0.33
24 0.34
25 0.41
26 0.45
27 0.5
28 0.53
29 0.58
30 0.6
31 0.66
32 0.66
33 0.64
34 0.62
35 0.62
36 0.62
37 0.6
38 0.57
39 0.51
40 0.5
41 0.44
42 0.37
43 0.33
44 0.29
45 0.22
46 0.17
47 0.13
48 0.08
49 0.07
50 0.06
51 0.04
52 0.04
53 0.03
54 0.05
55 0.05
56 0.05
57 0.05
58 0.06
59 0.1
60 0.12
61 0.13
62 0.14
63 0.15
64 0.15
65 0.15
66 0.15
67 0.12
68 0.1
69 0.11
70 0.09
71 0.1
72 0.09
73 0.11
74 0.16
75 0.16
76 0.17
77 0.18
78 0.18
79 0.19
80 0.26
81 0.33
82 0.3
83 0.37
84 0.41
85 0.51
86 0.6
87 0.67
88 0.72
89 0.72
90 0.78
91 0.74
92 0.8
93 0.76
94 0.76
95 0.75
96 0.75
97 0.74
98 0.72
99 0.74
100 0.66
101 0.63
102 0.56
103 0.53
104 0.46
105 0.38
106 0.32
107 0.27