Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067MU67

Protein Details
Accession A0A067MU67   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
2-45ASLAPPQPLDHRKRRRNRTTQSCMSCHLNKRKCDRQRPCQRCTNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
Amino Acid Sequences MASLAPPQPLDHRKRRRNRTTQSCMSCHLNKRKCDRQRPCQRCTNLGSTALCVYEVDDKHYRLVPGQDEVSHLRSRVAELEAVIREIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.85
3 0.88
4 0.89
5 0.92
6 0.92
7 0.91
8 0.9
9 0.86
10 0.78
11 0.71
12 0.66
13 0.62
14 0.6
15 0.6
16 0.57
17 0.58
18 0.64
19 0.7
20 0.73
21 0.78
22 0.78
23 0.79
24 0.83
25 0.84
26 0.81
27 0.79
28 0.72
29 0.66
30 0.61
31 0.54
32 0.45
33 0.4
34 0.35
35 0.27
36 0.25
37 0.2
38 0.16
39 0.1
40 0.09
41 0.12
42 0.12
43 0.16
44 0.19
45 0.2
46 0.22
47 0.24
48 0.23
49 0.2
50 0.23
51 0.2
52 0.21
53 0.21
54 0.2
55 0.21
56 0.24
57 0.26
58 0.24
59 0.22
60 0.2
61 0.19
62 0.21
63 0.21
64 0.19
65 0.16
66 0.16
67 0.2
68 0.19