Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067MCV1

Protein Details
Accession A0A067MCV1    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
10-40REEWIERNRVKKKRREREREKRREKEMEREKBasic
NLS Segment(s)
PositionSequence
16-46RNRVKKKRREREREKRREKEMEREKRSERNG
Subcellular Location(s) nucl 22, mito 3
Family & Domain DBs
Amino Acid Sequences MNDDRMDDEREEWIERNRVKKKRREREREKRREKEMEREKRSERNGDRETEREKWGVRLQIRWQVITKPKPKQYYDIRYAQGAPEAVPLH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.34
3 0.43
4 0.49
5 0.56
6 0.63
7 0.71
8 0.76
9 0.79
10 0.87
11 0.88
12 0.9
13 0.92
14 0.95
15 0.96
16 0.95
17 0.92
18 0.89
19 0.88
20 0.81
21 0.81
22 0.8
23 0.79
24 0.75
25 0.73
26 0.68
27 0.65
28 0.64
29 0.62
30 0.55
31 0.53
32 0.5
33 0.48
34 0.46
35 0.43
36 0.45
37 0.39
38 0.37
39 0.3
40 0.28
41 0.28
42 0.29
43 0.32
44 0.29
45 0.3
46 0.33
47 0.39
48 0.39
49 0.37
50 0.35
51 0.35
52 0.42
53 0.47
54 0.5
55 0.51
56 0.58
57 0.64
58 0.65
59 0.67
60 0.69
61 0.69
62 0.68
63 0.67
64 0.61
65 0.56
66 0.55
67 0.47
68 0.4
69 0.31
70 0.24