Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6QNI2

Protein Details
Accession B6QNI2    Localization Confidence Low Confidence Score 5.6
NoLS Segment(s)
PositionSequenceProtein Nature
207-227HDFRMRSRGLRRKMWWKNVKVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, extr 7, nucl 2, cyto 2, plas 2, cyto_nucl 2, pero 2, golg 2, cyto_pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR011012  Longin-like_dom_sf  
IPR010908  Longin_dom  
IPR001388  Synaptobrevin-like  
IPR042855  V_SNARE_CC  
Gene Ontology GO:0016020  C:membrane  
GO:0016192  P:vesicle-mediated transport  
KEGG tmf:PMAA_052800  -  
Pfam View protein in Pfam  
PF13774  Longin  
PF00957  Synaptobrevin  
PROSITE View protein in PROSITE  
PS50859  LONGIN  
PS00417  SYNAPTOBREVIN  
PS50892  V_SNARE  
CDD cd14824  Longin  
cd15843  R-SNARE  
Amino Acid Sequences MASSSKPTSTFLYSCIAHGTTILAEHSSPGASSTSASSLASIILPKISHDKPQKLTYTHDRLFVHYIADSPSSGNTQQDDNSKTPAGGELDSHSSLSYLVVATAEQGRRIPFAFLLEAKRKFLSAYPPSTTDFSALPAYGCAAYNSELRALLQQYNTAPPSDSLASARREIDSVRNIMTENIERVLERGERIDLLVDKTDRLGGTAHDFRMRSRGLRRKMWWKNVKVMVLLGVVVVFLIYLFVGMGCGLPAWGRCIGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.28
3 0.24
4 0.19
5 0.18
6 0.17
7 0.12
8 0.12
9 0.12
10 0.09
11 0.09
12 0.09
13 0.1
14 0.09
15 0.08
16 0.09
17 0.09
18 0.08
19 0.09
20 0.1
21 0.11
22 0.11
23 0.11
24 0.1
25 0.1
26 0.1
27 0.1
28 0.09
29 0.08
30 0.09
31 0.09
32 0.1
33 0.17
34 0.18
35 0.26
36 0.34
37 0.41
38 0.45
39 0.52
40 0.57
41 0.52
42 0.58
43 0.59
44 0.6
45 0.54
46 0.55
47 0.49
48 0.46
49 0.47
50 0.41
51 0.32
52 0.23
53 0.21
54 0.17
55 0.17
56 0.14
57 0.1
58 0.11
59 0.12
60 0.12
61 0.13
62 0.12
63 0.13
64 0.15
65 0.2
66 0.23
67 0.22
68 0.25
69 0.24
70 0.22
71 0.21
72 0.21
73 0.17
74 0.13
75 0.12
76 0.11
77 0.14
78 0.15
79 0.15
80 0.12
81 0.11
82 0.1
83 0.1
84 0.08
85 0.04
86 0.04
87 0.04
88 0.04
89 0.05
90 0.08
91 0.09
92 0.09
93 0.1
94 0.11
95 0.12
96 0.12
97 0.12
98 0.09
99 0.1
100 0.11
101 0.11
102 0.16
103 0.21
104 0.22
105 0.23
106 0.23
107 0.21
108 0.21
109 0.2
110 0.24
111 0.23
112 0.26
113 0.26
114 0.28
115 0.29
116 0.3
117 0.28
118 0.21
119 0.16
120 0.13
121 0.12
122 0.1
123 0.09
124 0.07
125 0.08
126 0.07
127 0.07
128 0.05
129 0.06
130 0.07
131 0.08
132 0.09
133 0.09
134 0.08
135 0.08
136 0.1
137 0.11
138 0.11
139 0.11
140 0.12
141 0.12
142 0.16
143 0.16
144 0.14
145 0.13
146 0.11
147 0.14
148 0.13
149 0.13
150 0.12
151 0.16
152 0.18
153 0.19
154 0.2
155 0.17
156 0.17
157 0.17
158 0.21
159 0.2
160 0.2
161 0.19
162 0.18
163 0.18
164 0.19
165 0.2
166 0.16
167 0.14
168 0.13
169 0.13
170 0.12
171 0.12
172 0.15
173 0.13
174 0.12
175 0.12
176 0.12
177 0.12
178 0.12
179 0.14
180 0.13
181 0.13
182 0.17
183 0.16
184 0.15
185 0.15
186 0.17
187 0.15
188 0.14
189 0.13
190 0.1
191 0.17
192 0.21
193 0.22
194 0.24
195 0.25
196 0.25
197 0.31
198 0.31
199 0.3
200 0.36
201 0.44
202 0.48
203 0.57
204 0.63
205 0.68
206 0.77
207 0.82
208 0.81
209 0.78
210 0.8
211 0.77
212 0.73
213 0.63
214 0.53
215 0.44
216 0.35
217 0.28
218 0.19
219 0.11
220 0.08
221 0.07
222 0.06
223 0.03
224 0.02
225 0.03
226 0.02
227 0.03
228 0.03
229 0.03
230 0.03
231 0.04
232 0.04
233 0.04
234 0.04
235 0.04
236 0.06
237 0.07
238 0.1