Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067MWN0

Protein Details
Accession A0A067MWN0    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
214-241AIWLSDDKEKKKKKKKSRRHPDGSAAGABasic
324-346PGGITARPPKKRRVDTPSHLPIQHydrophilic
NLS Segment(s)
PositionSequence
221-234KEKKKKKKKSRRHP
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013942  Mediator_Med19_fun  
IPR019403  Mediator_Med19_met  
Gene Ontology GO:0016592  C:mediator complex  
GO:0003712  F:transcription coregulator activity  
GO:0006357  P:regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF10278  Med19  
Amino Acid Sequences MADSHITPAISYATPSSTSFQGNGTPSRAPHSHEPSPLHAGPSSLPFFPPPMPRSQHTARLVNSTQDLLGRLHITPSYNSLVRPYLPHIRSTGQGKADGATVSGVEEKGKGKETQPMDGVIENGANSVSALGAGHTGGEAMDDSTGERKKKKFEHGYKSFISDLPGKHSAKKDTYLVNLVQQPPKQRMDITSFDSRTLEGFQLAPGVLQGFNQAIWLSDDKEKKKKKKKSRRHPDGSAAGATPAPDQSNPPGPPPIPPGPSSSASTPLPVSHLNGRGPATISTNGMHQHLGGASEYGFGGSGRVRKAPDEGGSPWSGQGMSPGPGGITARPPKKRRVDTPSHLPIQQPTPSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.18
3 0.2
4 0.19
5 0.21
6 0.21
7 0.2
8 0.24
9 0.25
10 0.27
11 0.28
12 0.28
13 0.27
14 0.33
15 0.33
16 0.33
17 0.39
18 0.43
19 0.46
20 0.5
21 0.53
22 0.52
23 0.58
24 0.54
25 0.47
26 0.39
27 0.34
28 0.29
29 0.31
30 0.28
31 0.21
32 0.2
33 0.19
34 0.21
35 0.24
36 0.31
37 0.28
38 0.33
39 0.38
40 0.4
41 0.46
42 0.49
43 0.54
44 0.52
45 0.56
46 0.49
47 0.52
48 0.51
49 0.46
50 0.43
51 0.34
52 0.28
53 0.23
54 0.23
55 0.15
56 0.16
57 0.15
58 0.13
59 0.14
60 0.15
61 0.15
62 0.14
63 0.18
64 0.2
65 0.19
66 0.19
67 0.21
68 0.21
69 0.21
70 0.22
71 0.24
72 0.29
73 0.29
74 0.31
75 0.31
76 0.31
77 0.34
78 0.36
79 0.36
80 0.28
81 0.29
82 0.27
83 0.25
84 0.24
85 0.2
86 0.16
87 0.11
88 0.09
89 0.08
90 0.08
91 0.08
92 0.07
93 0.08
94 0.1
95 0.11
96 0.14
97 0.15
98 0.15
99 0.22
100 0.24
101 0.26
102 0.26
103 0.26
104 0.24
105 0.23
106 0.22
107 0.15
108 0.13
109 0.09
110 0.08
111 0.06
112 0.05
113 0.04
114 0.04
115 0.03
116 0.03
117 0.03
118 0.03
119 0.03
120 0.03
121 0.03
122 0.03
123 0.03
124 0.03
125 0.03
126 0.03
127 0.03
128 0.03
129 0.03
130 0.04
131 0.08
132 0.12
133 0.15
134 0.19
135 0.22
136 0.29
137 0.36
138 0.46
139 0.52
140 0.59
141 0.67
142 0.69
143 0.73
144 0.66
145 0.63
146 0.54
147 0.43
148 0.36
149 0.29
150 0.22
151 0.22
152 0.27
153 0.25
154 0.28
155 0.31
156 0.33
157 0.31
158 0.33
159 0.3
160 0.26
161 0.27
162 0.26
163 0.23
164 0.23
165 0.24
166 0.25
167 0.25
168 0.25
169 0.26
170 0.28
171 0.29
172 0.26
173 0.23
174 0.23
175 0.26
176 0.27
177 0.29
178 0.31
179 0.3
180 0.29
181 0.29
182 0.26
183 0.21
184 0.19
185 0.15
186 0.09
187 0.08
188 0.08
189 0.08
190 0.08
191 0.07
192 0.05
193 0.06
194 0.05
195 0.05
196 0.06
197 0.05
198 0.05
199 0.06
200 0.05
201 0.05
202 0.07
203 0.08
204 0.1
205 0.15
206 0.21
207 0.26
208 0.36
209 0.45
210 0.54
211 0.64
212 0.72
213 0.78
214 0.83
215 0.9
216 0.92
217 0.94
218 0.95
219 0.94
220 0.9
221 0.87
222 0.82
223 0.73
224 0.63
225 0.52
226 0.41
227 0.32
228 0.25
229 0.17
230 0.12
231 0.1
232 0.09
233 0.1
234 0.13
235 0.21
236 0.21
237 0.23
238 0.26
239 0.25
240 0.28
241 0.33
242 0.35
243 0.3
244 0.3
245 0.33
246 0.33
247 0.36
248 0.36
249 0.3
250 0.29
251 0.26
252 0.27
253 0.23
254 0.18
255 0.19
256 0.17
257 0.18
258 0.2
259 0.24
260 0.23
261 0.26
262 0.27
263 0.25
264 0.26
265 0.25
266 0.23
267 0.2
268 0.2
269 0.17
270 0.19
271 0.19
272 0.18
273 0.17
274 0.13
275 0.13
276 0.12
277 0.13
278 0.1
279 0.09
280 0.08
281 0.09
282 0.09
283 0.07
284 0.07
285 0.06
286 0.07
287 0.09
288 0.13
289 0.15
290 0.18
291 0.19
292 0.21
293 0.25
294 0.28
295 0.28
296 0.29
297 0.29
298 0.31
299 0.32
300 0.31
301 0.27
302 0.23
303 0.2
304 0.15
305 0.17
306 0.15
307 0.14
308 0.14
309 0.14
310 0.13
311 0.14
312 0.16
313 0.14
314 0.2
315 0.27
316 0.36
317 0.46
318 0.51
319 0.59
320 0.69
321 0.76
322 0.77
323 0.79
324 0.81
325 0.8
326 0.86
327 0.85
328 0.79
329 0.72
330 0.64
331 0.59
332 0.55