Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6QHM1

Protein Details
Accession B6QHM1    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
19-46RYQNDKPSSLPRYRRRKGNIRGPAPRGLHydrophilic
NLS Segment(s)
PositionSequence
32-40RRRKGNIRG
Subcellular Location(s) nucl 15.5, cyto_nucl 10.5, cyto 4.5, pero 3, mito 2, vacu 2
Family & Domain DBs
KEGG tmf:PMAA_094710  -  
Amino Acid Sequences MARLKKGGVHSWEDVLAQRYQNDKPSSLPRYRRRKGNIRGPAPRGLEISQTPDQQPECLLLNKLPPELRLVIWEMVLGGLRLHIIQRSKRRLGCVICPQEDTCDICRGVLQQPVKSTETCCSNVNLISLLVSCKQIYRESIHLLYSSNTFEFSNTWSLAYLRPTIPPNQWTAIRKVDLKWAFPGHWLPSKDSVKSVYVWAGRQQWIETCKAILLLKNLEEFTLHLTGNWFGEPIEKVPVFLDPLRDLHLRDWPGRKWRIYLPPQPYYKMEIARLNELMMKERIFCEVYEAGQC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.29
3 0.27
4 0.22
5 0.24
6 0.26
7 0.28
8 0.36
9 0.36
10 0.35
11 0.37
12 0.45
13 0.49
14 0.54
15 0.61
16 0.63
17 0.71
18 0.77
19 0.81
20 0.82
21 0.84
22 0.85
23 0.86
24 0.86
25 0.85
26 0.86
27 0.81
28 0.79
29 0.71
30 0.63
31 0.55
32 0.46
33 0.4
34 0.32
35 0.35
36 0.31
37 0.3
38 0.29
39 0.3
40 0.29
41 0.26
42 0.25
43 0.2
44 0.19
45 0.19
46 0.19
47 0.17
48 0.21
49 0.22
50 0.25
51 0.24
52 0.21
53 0.23
54 0.23
55 0.22
56 0.2
57 0.21
58 0.18
59 0.17
60 0.16
61 0.12
62 0.11
63 0.1
64 0.08
65 0.05
66 0.04
67 0.04
68 0.05
69 0.05
70 0.08
71 0.13
72 0.2
73 0.3
74 0.38
75 0.45
76 0.47
77 0.51
78 0.55
79 0.54
80 0.54
81 0.55
82 0.54
83 0.49
84 0.49
85 0.45
86 0.4
87 0.38
88 0.33
89 0.25
90 0.22
91 0.2
92 0.18
93 0.18
94 0.18
95 0.19
96 0.21
97 0.21
98 0.19
99 0.21
100 0.25
101 0.27
102 0.25
103 0.24
104 0.22
105 0.24
106 0.24
107 0.22
108 0.2
109 0.19
110 0.19
111 0.18
112 0.15
113 0.11
114 0.09
115 0.08
116 0.08
117 0.08
118 0.08
119 0.07
120 0.08
121 0.09
122 0.1
123 0.12
124 0.14
125 0.16
126 0.18
127 0.19
128 0.19
129 0.18
130 0.17
131 0.16
132 0.14
133 0.12
134 0.09
135 0.09
136 0.08
137 0.08
138 0.08
139 0.1
140 0.11
141 0.1
142 0.1
143 0.1
144 0.1
145 0.12
146 0.13
147 0.13
148 0.11
149 0.14
150 0.15
151 0.18
152 0.2
153 0.2
154 0.21
155 0.22
156 0.25
157 0.25
158 0.27
159 0.28
160 0.28
161 0.28
162 0.26
163 0.33
164 0.3
165 0.29
166 0.29
167 0.27
168 0.25
169 0.26
170 0.27
171 0.22
172 0.26
173 0.26
174 0.25
175 0.32
176 0.34
177 0.33
178 0.32
179 0.31
180 0.26
181 0.26
182 0.24
183 0.2
184 0.2
185 0.2
186 0.23
187 0.25
188 0.26
189 0.26
190 0.25
191 0.24
192 0.25
193 0.26
194 0.22
195 0.17
196 0.16
197 0.17
198 0.17
199 0.15
200 0.16
201 0.16
202 0.17
203 0.19
204 0.19
205 0.17
206 0.16
207 0.14
208 0.15
209 0.15
210 0.13
211 0.12
212 0.13
213 0.14
214 0.14
215 0.14
216 0.1
217 0.08
218 0.11
219 0.12
220 0.11
221 0.17
222 0.16
223 0.16
224 0.17
225 0.18
226 0.19
227 0.19
228 0.21
229 0.17
230 0.18
231 0.22
232 0.23
233 0.23
234 0.22
235 0.28
236 0.28
237 0.33
238 0.38
239 0.4
240 0.49
241 0.54
242 0.54
243 0.52
244 0.56
245 0.6
246 0.63
247 0.66
248 0.65
249 0.66
250 0.68
251 0.68
252 0.62
253 0.57
254 0.54
255 0.49
256 0.46
257 0.44
258 0.43
259 0.45
260 0.42
261 0.37
262 0.35
263 0.32
264 0.31
265 0.27
266 0.25
267 0.21
268 0.21
269 0.24
270 0.22
271 0.21
272 0.22
273 0.21