Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067MCJ5

Protein Details
Accession A0A067MCJ5   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
40-83TSEGERKEKKREEEREKKRREKRREKRKEERRGERKEKMRDIAPBasic
NLS Segment(s)
PositionSequence
45-79RKEKKREEEREKKRREKRREKRKEERRGERKEKMR
Subcellular Location(s) nucl 16, mito 10
Family & Domain DBs
Amino Acid Sequences MRAMRFQQGLTWADSTCTSLNLEGPCGLSIKNKTIWDTLTSEGERKEKKREEEREKKRREKRREKRKEERRGERKEKMRDIAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.21
3 0.16
4 0.15
5 0.12
6 0.11
7 0.15
8 0.14
9 0.15
10 0.13
11 0.13
12 0.12
13 0.12
14 0.12
15 0.13
16 0.14
17 0.17
18 0.21
19 0.21
20 0.22
21 0.23
22 0.24
23 0.22
24 0.22
25 0.21
26 0.19
27 0.19
28 0.18
29 0.18
30 0.22
31 0.24
32 0.24
33 0.31
34 0.34
35 0.41
36 0.5
37 0.59
38 0.65
39 0.72
40 0.81
41 0.83
42 0.87
43 0.89
44 0.89
45 0.89
46 0.9
47 0.9
48 0.9
49 0.91
50 0.93
51 0.93
52 0.95
53 0.95
54 0.95
55 0.94
56 0.94
57 0.93
58 0.93
59 0.92
60 0.91
61 0.9
62 0.89
63 0.86