Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067MK76

Protein Details
Accession A0A067MK76    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
23-47WSPGAAWKRNVKKRRKMVDRMVERPHydrophilic
NLS Segment(s)
PositionSequence
30-38KRNVKKRRK
Subcellular Location(s) mito 20, nucl 3, cyto 2, plas 2
Family & Domain DBs
Amino Acid Sequences MTYNIRRTLIAASLLSVRFIPSWSPGAAWKRNVKKRRKMVDRMVERPLQRVKAKLVDITDYWYNHSNRGSTANIAISGGRNCPAFRCISHGIRWRIRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.16
4 0.15
5 0.12
6 0.12
7 0.12
8 0.11
9 0.14
10 0.13
11 0.14
12 0.19
13 0.26
14 0.29
15 0.34
16 0.4
17 0.48
18 0.57
19 0.65
20 0.7
21 0.73
22 0.79
23 0.84
24 0.84
25 0.83
26 0.84
27 0.85
28 0.83
29 0.77
30 0.71
31 0.64
32 0.55
33 0.51
34 0.44
35 0.39
36 0.32
37 0.3
38 0.28
39 0.28
40 0.29
41 0.26
42 0.24
43 0.21
44 0.2
45 0.22
46 0.22
47 0.18
48 0.19
49 0.23
50 0.22
51 0.23
52 0.24
53 0.21
54 0.19
55 0.23
56 0.22
57 0.17
58 0.19
59 0.17
60 0.16
61 0.15
62 0.15
63 0.13
64 0.13
65 0.13
66 0.13
67 0.13
68 0.13
69 0.15
70 0.17
71 0.18
72 0.18
73 0.24
74 0.29
75 0.32
76 0.4
77 0.47
78 0.54