Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067N6J6

Protein Details
Accession A0A067N6J6    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
9-33EPSVNPRRGRPGKARRKERDKVVSABasic
NLS Segment(s)
PositionSequence
14-27PRRGRPGKARRKER
Subcellular Location(s) nucl 21, cyto_nucl 13.5, cyto 4
Family & Domain DBs
Amino Acid Sequences MFPSCHQREPSVNPRRGRPGKARRKERDKVVSAEQLASEHYKDQGFQGYRSEGRVVSTKYIHAPLLIRSTRPSPRSIRDTLPDRAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.7
3 0.69
4 0.68
5 0.68
6 0.69
7 0.73
8 0.8
9 0.84
10 0.84
11 0.87
12 0.87
13 0.86
14 0.85
15 0.78
16 0.72
17 0.67
18 0.61
19 0.52
20 0.46
21 0.36
22 0.26
23 0.22
24 0.19
25 0.14
26 0.09
27 0.09
28 0.09
29 0.09
30 0.09
31 0.14
32 0.14
33 0.15
34 0.16
35 0.18
36 0.18
37 0.2
38 0.2
39 0.14
40 0.15
41 0.19
42 0.18
43 0.19
44 0.19
45 0.19
46 0.21
47 0.22
48 0.21
49 0.17
50 0.17
51 0.17
52 0.25
53 0.24
54 0.23
55 0.24
56 0.3
57 0.37
58 0.38
59 0.41
60 0.39
61 0.46
62 0.52
63 0.54
64 0.54
65 0.55
66 0.58