Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6Q2T9

Protein Details
Accession B6Q2T9   
Localization Confidence Low
Confidence Score 6.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-48AAKSHIPIVKKRTKRFFRHQSDTFKCVPSSWRKPKGIDNRVRRRFKGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15.5, mito_nucl 11.5, nucl 6.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG tmf:PMAA_038200  -  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAAKSHIPIVKKRTKRFFRHQSDTFKCVPSSWRKPKGIDNRVRRRFKGTIAMPSIGYGSNKKTRHLMPSGHKAFLVHNIKDVELLLMHNRTYAAEIASAVSSRKRVDILAKAKALGVKVTNAKARVTTES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.82
3 0.86
4 0.87
5 0.87
6 0.88
7 0.86
8 0.86
9 0.82
10 0.78
11 0.7
12 0.61
13 0.52
14 0.43
15 0.43
16 0.42
17 0.47
18 0.52
19 0.58
20 0.59
21 0.62
22 0.7
23 0.74
24 0.74
25 0.73
26 0.73
27 0.75
28 0.81
29 0.84
30 0.77
31 0.73
32 0.65
33 0.59
34 0.57
35 0.49
36 0.47
37 0.44
38 0.43
39 0.36
40 0.33
41 0.3
42 0.21
43 0.19
44 0.12
45 0.13
46 0.2
47 0.21
48 0.22
49 0.25
50 0.26
51 0.31
52 0.33
53 0.36
54 0.34
55 0.44
56 0.45
57 0.42
58 0.4
59 0.35
60 0.31
61 0.34
62 0.34
63 0.23
64 0.25
65 0.25
66 0.25
67 0.24
68 0.24
69 0.15
70 0.09
71 0.1
72 0.09
73 0.09
74 0.09
75 0.09
76 0.09
77 0.09
78 0.1
79 0.1
80 0.08
81 0.08
82 0.08
83 0.09
84 0.09
85 0.09
86 0.08
87 0.09
88 0.11
89 0.12
90 0.13
91 0.13
92 0.14
93 0.2
94 0.29
95 0.34
96 0.39
97 0.4
98 0.39
99 0.39
100 0.39
101 0.34
102 0.28
103 0.23
104 0.21
105 0.25
106 0.3
107 0.34
108 0.34
109 0.34
110 0.34