Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067MBJ4

Protein Details
Accession A0A067MBJ4    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-21GKLKPLKAPKKEKKDEDEEDKBasic
NLS Segment(s)
PositionSequence
4-14KPLKAPKKEKK
Subcellular Location(s) nucl 22, cyto 2, mito 1, pero 1, cysk 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR015157  TMA7  
Pfam View protein in Pfam  
PF09072  TMA7  
Amino Acid Sequences GKLKPLKAPKKEKKDEDEEDKAFKAKQKADAAALKDAQARGWLLSRIARRLQVSSPTSVRDPSFQKWSFSRRGHQEVWQEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.82
3 0.8
4 0.77
5 0.69
6 0.62
7 0.55
8 0.48
9 0.4
10 0.37
11 0.35
12 0.3
13 0.35
14 0.36
15 0.37
16 0.4
17 0.43
18 0.41
19 0.37
20 0.34
21 0.27
22 0.24
23 0.22
24 0.17
25 0.14
26 0.11
27 0.09
28 0.1
29 0.09
30 0.08
31 0.13
32 0.14
33 0.17
34 0.18
35 0.21
36 0.21
37 0.23
38 0.25
39 0.28
40 0.28
41 0.29
42 0.29
43 0.29
44 0.29
45 0.29
46 0.27
47 0.25
48 0.28
49 0.28
50 0.36
51 0.35
52 0.38
53 0.41
54 0.47
55 0.51
56 0.52
57 0.56
58 0.56
59 0.61
60 0.6
61 0.62