Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067M3G1

Protein Details
Accession A0A067M3G1    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
43-65KGSHTGRPRRREREERVRVRARDBasic
NLS Segment(s)
PositionSequence
47-62TGRPRRREREERVRVR
Subcellular Location(s) cysk 12, cyto_nucl 9, nucl 8.5, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MALDYLTIPATSVDSIQASIVFGNQCKEGLINDDKLIMLLRDKGSHTGRPRRREREERVRVRARDSRLDTGDEEEDEEDGDTDLGMDDLDGDWDIID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.09
4 0.09
5 0.08
6 0.07
7 0.09
8 0.09
9 0.09
10 0.11
11 0.11
12 0.11
13 0.1
14 0.11
15 0.09
16 0.14
17 0.16
18 0.16
19 0.16
20 0.16
21 0.16
22 0.15
23 0.15
24 0.1
25 0.08
26 0.09
27 0.1
28 0.11
29 0.12
30 0.16
31 0.19
32 0.24
33 0.3
34 0.38
35 0.44
36 0.52
37 0.6
38 0.64
39 0.7
40 0.74
41 0.76
42 0.77
43 0.81
44 0.8
45 0.81
46 0.81
47 0.73
48 0.7
49 0.67
50 0.6
51 0.58
52 0.55
53 0.52
54 0.45
55 0.46
56 0.4
57 0.37
58 0.34
59 0.25
60 0.21
61 0.15
62 0.14
63 0.12
64 0.11
65 0.08
66 0.07
67 0.06
68 0.05
69 0.05
70 0.05
71 0.04
72 0.04
73 0.03
74 0.04
75 0.04
76 0.05
77 0.05