Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067MBX6

Protein Details
Accession A0A067MBX6   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
6-25THTLCRRCGNRAFHRQHKTCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, cyto 9, mito_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR011331  Ribosomal_L37ae/L37e  
IPR001569  Ribosomal_L37e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0005840  C:ribosome  
GO:0046872  F:metal ion binding  
GO:0019843  F:rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01907  Ribosomal_L37e  
Amino Acid Sequences KRHTKTHTLCRRCGNRAFHRQHKTCAQCGYPSAKIRSYNWGLKAKRRKTTGTGRMSYLKEVSRRFKNGFRENTTAVKRSKPAAADA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.73
3 0.76
4 0.79
5 0.79
6 0.81
7 0.78
8 0.76
9 0.75
10 0.7
11 0.64
12 0.6
13 0.51
14 0.43
15 0.42
16 0.42
17 0.38
18 0.38
19 0.36
20 0.35
21 0.35
22 0.35
23 0.39
24 0.38
25 0.37
26 0.38
27 0.44
28 0.42
29 0.48
30 0.56
31 0.56
32 0.57
33 0.56
34 0.54
35 0.52
36 0.62
37 0.63
38 0.61
39 0.56
40 0.52
41 0.54
42 0.52
43 0.47
44 0.39
45 0.33
46 0.31
47 0.34
48 0.39
49 0.4
50 0.45
51 0.48
52 0.51
53 0.58
54 0.62
55 0.65
56 0.64
57 0.63
58 0.6
59 0.65
60 0.63
61 0.59
62 0.52
63 0.49
64 0.45
65 0.43
66 0.44