Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067MUB9

Protein Details
Accession A0A067MUB9   
Localization Confidence Low
Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
55-82GECNAKTVLRRRRSKYCRSANCAQCHRLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 8, plas 3
Family & Domain DBs
Amino Acid Sequences MHIQTSNRMVGLGLFGSIDPGPRWRLVAIRCREYRHEKQPASKRRHLCCRRRGCGECNAKTVLRRRRSKYCRSANCAQCHRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.08
4 0.08
5 0.09
6 0.08
7 0.11
8 0.13
9 0.13
10 0.14
11 0.13
12 0.18
13 0.22
14 0.31
15 0.34
16 0.4
17 0.42
18 0.44
19 0.49
20 0.53
21 0.56
22 0.56
23 0.6
24 0.55
25 0.61
26 0.68
27 0.71
28 0.71
29 0.71
30 0.69
31 0.67
32 0.75
33 0.76
34 0.76
35 0.77
36 0.79
37 0.77
38 0.78
39 0.76
40 0.7
41 0.69
42 0.7
43 0.63
44 0.56
45 0.53
46 0.46
47 0.46
48 0.51
49 0.51
50 0.51
51 0.56
52 0.6
53 0.68
54 0.76
55 0.81
56 0.83
57 0.84
58 0.84
59 0.83
60 0.86
61 0.84
62 0.85