Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067MY74

Protein Details
Accession A0A067MY74    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
48-73RAAPYRLVGKKKKKRVYTSSQRGNKLHydrophilic
NLS Segment(s)
PositionSequence
56-62GKKKKKR
Subcellular Location(s) extr 17, plas 4, pero 2, nucl 1, mito 1, E.R. 1, vacu 1, mito_nucl 1, cyto_pero 1
Family & Domain DBs
Amino Acid Sequences MVAFVWAFVWFYSAVLPANLSPLANRENPGTPGSQSSKAHPPSCFHPRAAPYRLVGKKKKKRVYTSSQRGNKLAVQLDAVVNKW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.09
4 0.08
5 0.1
6 0.1
7 0.09
8 0.08
9 0.11
10 0.14
11 0.14
12 0.16
13 0.16
14 0.18
15 0.2
16 0.21
17 0.19
18 0.16
19 0.19
20 0.22
21 0.25
22 0.24
23 0.25
24 0.32
25 0.35
26 0.38
27 0.35
28 0.33
29 0.34
30 0.41
31 0.4
32 0.32
33 0.32
34 0.34
35 0.39
36 0.41
37 0.37
38 0.3
39 0.38
40 0.43
41 0.47
42 0.52
43 0.57
44 0.63
45 0.72
46 0.79
47 0.79
48 0.82
49 0.83
50 0.84
51 0.85
52 0.86
53 0.86
54 0.85
55 0.8
56 0.72
57 0.66
58 0.58
59 0.52
60 0.44
61 0.35
62 0.28
63 0.25
64 0.27