Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067MLZ0

Protein Details
Accession A0A067MLZ0    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
65-87RASQRKRDERYARLTKKPGRYARBasic
NLS Segment(s)
PositionSequence
69-87RKRDERYARLTKKPGRYAR
Subcellular Location(s) nucl 13, mito 7, cyto 5
Family & Domain DBs
Amino Acid Sequences MPTTRKEAAGRTDWRREETGARNRDQPLRHADASYQGLQSTSTRRPRWPNGLANCIIIMHGGEPRASQRKRDERYARLTKKPGRYAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.54
3 0.49
4 0.48
5 0.5
6 0.52
7 0.49
8 0.48
9 0.5
10 0.51
11 0.54
12 0.49
13 0.44
14 0.42
15 0.42
16 0.41
17 0.36
18 0.33
19 0.32
20 0.33
21 0.3
22 0.23
23 0.16
24 0.15
25 0.16
26 0.16
27 0.16
28 0.19
29 0.26
30 0.27
31 0.32
32 0.39
33 0.44
34 0.51
35 0.53
36 0.55
37 0.52
38 0.55
39 0.51
40 0.45
41 0.39
42 0.31
43 0.24
44 0.15
45 0.11
46 0.06
47 0.06
48 0.06
49 0.07
50 0.07
51 0.13
52 0.23
53 0.24
54 0.29
55 0.38
56 0.48
57 0.53
58 0.64
59 0.67
60 0.65
61 0.75
62 0.8
63 0.77
64 0.76
65 0.8
66 0.78
67 0.8