Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067M8M6

Protein Details
Accession A0A067M8M6    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
76-101KKTTMACHFCRKRKLKCDGLRPSCNGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MFRGISNIPSGTQSSTSVASEGYSSAGAAEKGDEGDNGSVGGHSGGQGGSNQGEDTQMGDTEGNDGEKEKKQVPPKKTTMACHFCRKRKLKCDGLRPSCNGCIRRSLMCTYDPVIRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.18
4 0.16
5 0.14
6 0.12
7 0.11
8 0.1
9 0.09
10 0.07
11 0.06
12 0.06
13 0.07
14 0.07
15 0.06
16 0.07
17 0.06
18 0.07
19 0.07
20 0.07
21 0.08
22 0.08
23 0.08
24 0.07
25 0.07
26 0.06
27 0.05
28 0.06
29 0.04
30 0.04
31 0.04
32 0.04
33 0.04
34 0.05
35 0.05
36 0.06
37 0.06
38 0.06
39 0.05
40 0.05
41 0.05
42 0.06
43 0.05
44 0.05
45 0.05
46 0.05
47 0.05
48 0.06
49 0.06
50 0.05
51 0.05
52 0.06
53 0.09
54 0.11
55 0.14
56 0.15
57 0.21
58 0.31
59 0.39
60 0.44
61 0.5
62 0.53
63 0.59
64 0.61
65 0.62
66 0.62
67 0.63
68 0.61
69 0.63
70 0.67
71 0.66
72 0.72
73 0.75
74 0.74
75 0.76
76 0.8
77 0.8
78 0.8
79 0.83
80 0.84
81 0.85
82 0.81
83 0.76
84 0.72
85 0.68
86 0.67
87 0.59
88 0.5
89 0.48
90 0.45
91 0.45
92 0.44
93 0.41
94 0.36
95 0.35
96 0.37
97 0.32
98 0.36