Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067MPV1

Protein Details
Accession A0A067MPV1    Localization Confidence High Confidence Score 17.9
NoLS Segment(s)
PositionSequenceProtein Nature
37-63CILKGIFPREPRHKKRANKGSTAPTTFHydrophilic
563-582FEEKLKKAVKKAKKSGTAVVHydrophilic
603-650SNKQRKLYERMKYSERKRTDERKAIEVKKELIRKEEKKKARKSAAGGKBasic
NLS Segment(s)
PositionSequence
46-53EPRHKKRA
566-583KLKKAVKKAKKSGTAVVK
613-650MKYSERKRTDERKAIEVKKELIRKEEKKKARKSAAGGK
Subcellular Location(s) cyto_mito 11.666, mito 11.5, cyto 9.5, mito_nucl 8.999, cyto_nucl 7.999, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001357  BRCT_dom  
IPR036420  BRCT_dom_sf  
IPR010613  PES  
Gene Ontology GO:0005730  C:nucleolus  
GO:0005654  C:nucleoplasm  
GO:0030687  C:preribosome, large subunit precursor  
GO:0043021  F:ribonucleoprotein complex binding  
GO:0000466  P:maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
Pfam View protein in Pfam  
PF06732  Pescadillo_N  
PROSITE View protein in PROSITE  
PS50172  BRCT  
Amino Acid Sequences MGKIQKKGEKGAAKAYVTRSAAVKKLQCSLADFRRLCILKGIFPREPRHKKRANKGSTAPTTFYYAKDIAYIAHEPVLRKLREHKAFAKKLSRALGRGEWSSAKSLEDHKPTYTLDHVIKERYPTFIDALRDIDDALCLITLFASLPSDSRVSPALIESCYRLSSEWQLYVMHTRSLRKVFLSIKGVYYQAEVMGETVTWLVPYMFTQQIPTDVDTRVMLTFLELYQTLLGFVFFKLYSDAGLVYPPPLDLSKDEGAAGVGAFSLLETKEEEKADEANAPSTKKQVEVEGKVIKGKDVRKTIKELANLALPPQEATSAREISAETSTLESTIGEEFVVQPSSNASGAAASLPTLHTLSTLPAAPTTLFAPYTIWLTIGTPRPLLEFAIRAFGGRVGWPETMGSGSPITEDDESITHVIIDRPLPANLAPEQVELRRRRKYVQPQWVVDCINAGKLIIEGPYAQGATLPPHLSPFGELEGAYMPAVGEESADAEMEAAEDEESEDEEVAEGEEEAVAADADAEMVAEPATASALEAAAKAPSDPALLRAAELEAERAGLDSAAFEEKLKKAVKKAKKSGTAVVKEKKEADEAAAEGEMNKMMMSNKQRKLYERMKYSERKRTDERKAIEVKKELIRKEEKKKARKSAAGGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.54
3 0.52
4 0.46
5 0.44
6 0.4
7 0.37
8 0.4
9 0.42
10 0.44
11 0.39
12 0.44
13 0.46
14 0.43
15 0.44
16 0.48
17 0.49
18 0.54
19 0.51
20 0.45
21 0.51
22 0.5
23 0.45
24 0.45
25 0.39
26 0.36
27 0.45
28 0.51
29 0.47
30 0.53
31 0.61
32 0.64
33 0.73
34 0.74
35 0.76
36 0.78
37 0.82
38 0.87
39 0.89
40 0.86
41 0.84
42 0.84
43 0.84
44 0.83
45 0.77
46 0.69
47 0.59
48 0.57
49 0.48
50 0.41
51 0.36
52 0.28
53 0.24
54 0.23
55 0.21
56 0.16
57 0.19
58 0.2
59 0.15
60 0.18
61 0.2
62 0.2
63 0.27
64 0.35
65 0.31
66 0.32
67 0.4
68 0.47
69 0.53
70 0.58
71 0.61
72 0.63
73 0.7
74 0.75
75 0.76
76 0.69
77 0.68
78 0.69
79 0.64
80 0.55
81 0.53
82 0.51
83 0.46
84 0.43
85 0.4
86 0.35
87 0.32
88 0.33
89 0.28
90 0.23
91 0.21
92 0.26
93 0.31
94 0.34
95 0.35
96 0.33
97 0.35
98 0.35
99 0.36
100 0.33
101 0.3
102 0.27
103 0.3
104 0.32
105 0.33
106 0.34
107 0.36
108 0.34
109 0.31
110 0.3
111 0.26
112 0.26
113 0.27
114 0.27
115 0.24
116 0.25
117 0.23
118 0.21
119 0.19
120 0.17
121 0.13
122 0.1
123 0.09
124 0.07
125 0.05
126 0.04
127 0.04
128 0.04
129 0.04
130 0.04
131 0.05
132 0.05
133 0.06
134 0.08
135 0.1
136 0.1
137 0.11
138 0.12
139 0.12
140 0.12
141 0.14
142 0.14
143 0.13
144 0.14
145 0.15
146 0.15
147 0.15
148 0.15
149 0.13
150 0.14
151 0.19
152 0.21
153 0.21
154 0.2
155 0.2
156 0.21
157 0.27
158 0.25
159 0.23
160 0.22
161 0.24
162 0.29
163 0.31
164 0.32
165 0.27
166 0.31
167 0.31
168 0.34
169 0.37
170 0.32
171 0.31
172 0.31
173 0.3
174 0.25
175 0.22
176 0.16
177 0.11
178 0.1
179 0.08
180 0.07
181 0.07
182 0.06
183 0.05
184 0.05
185 0.05
186 0.04
187 0.04
188 0.04
189 0.04
190 0.05
191 0.09
192 0.11
193 0.11
194 0.12
195 0.13
196 0.15
197 0.17
198 0.17
199 0.15
200 0.14
201 0.15
202 0.14
203 0.15
204 0.12
205 0.11
206 0.09
207 0.07
208 0.07
209 0.06
210 0.07
211 0.06
212 0.06
213 0.07
214 0.07
215 0.06
216 0.06
217 0.06
218 0.05
219 0.05
220 0.07
221 0.06
222 0.07
223 0.07
224 0.08
225 0.08
226 0.07
227 0.08
228 0.06
229 0.07
230 0.07
231 0.06
232 0.06
233 0.06
234 0.06
235 0.06
236 0.07
237 0.08
238 0.13
239 0.14
240 0.14
241 0.14
242 0.13
243 0.13
244 0.12
245 0.1
246 0.05
247 0.03
248 0.03
249 0.03
250 0.02
251 0.03
252 0.03
253 0.04
254 0.05
255 0.06
256 0.09
257 0.1
258 0.1
259 0.1
260 0.11
261 0.11
262 0.13
263 0.12
264 0.13
265 0.15
266 0.16
267 0.15
268 0.17
269 0.17
270 0.16
271 0.16
272 0.19
273 0.23
274 0.25
275 0.3
276 0.31
277 0.31
278 0.31
279 0.31
280 0.26
281 0.24
282 0.26
283 0.27
284 0.33
285 0.37
286 0.38
287 0.44
288 0.48
289 0.48
290 0.46
291 0.4
292 0.33
293 0.31
294 0.28
295 0.23
296 0.18
297 0.13
298 0.11
299 0.1
300 0.1
301 0.08
302 0.1
303 0.12
304 0.11
305 0.12
306 0.12
307 0.12
308 0.12
309 0.12
310 0.1
311 0.08
312 0.08
313 0.07
314 0.07
315 0.07
316 0.05
317 0.06
318 0.05
319 0.05
320 0.04
321 0.04
322 0.05
323 0.05
324 0.06
325 0.05
326 0.05
327 0.05
328 0.07
329 0.07
330 0.06
331 0.05
332 0.05
333 0.05
334 0.05
335 0.05
336 0.03
337 0.04
338 0.04
339 0.05
340 0.05
341 0.05
342 0.05
343 0.06
344 0.06
345 0.07
346 0.08
347 0.07
348 0.07
349 0.08
350 0.07
351 0.08
352 0.07
353 0.07
354 0.06
355 0.07
356 0.07
357 0.07
358 0.09
359 0.08
360 0.07
361 0.07
362 0.07
363 0.12
364 0.15
365 0.15
366 0.14
367 0.14
368 0.15
369 0.15
370 0.16
371 0.12
372 0.1
373 0.1
374 0.13
375 0.12
376 0.11
377 0.11
378 0.11
379 0.1
380 0.09
381 0.1
382 0.1
383 0.1
384 0.1
385 0.1
386 0.1
387 0.1
388 0.09
389 0.09
390 0.06
391 0.06
392 0.06
393 0.07
394 0.08
395 0.08
396 0.08
397 0.07
398 0.07
399 0.09
400 0.09
401 0.08
402 0.06
403 0.07
404 0.08
405 0.08
406 0.08
407 0.09
408 0.11
409 0.11
410 0.12
411 0.11
412 0.13
413 0.13
414 0.15
415 0.13
416 0.13
417 0.14
418 0.16
419 0.23
420 0.28
421 0.34
422 0.39
423 0.4
424 0.44
425 0.52
426 0.61
427 0.63
428 0.67
429 0.69
430 0.66
431 0.68
432 0.67
433 0.58
434 0.46
435 0.38
436 0.27
437 0.2
438 0.16
439 0.11
440 0.08
441 0.07
442 0.08
443 0.06
444 0.06
445 0.05
446 0.06
447 0.07
448 0.07
449 0.07
450 0.07
451 0.07
452 0.09
453 0.12
454 0.12
455 0.11
456 0.13
457 0.13
458 0.13
459 0.14
460 0.13
461 0.11
462 0.11
463 0.11
464 0.1
465 0.11
466 0.11
467 0.09
468 0.08
469 0.06
470 0.05
471 0.06
472 0.05
473 0.04
474 0.03
475 0.05
476 0.05
477 0.05
478 0.05
479 0.05
480 0.05
481 0.05
482 0.05
483 0.04
484 0.04
485 0.04
486 0.04
487 0.04
488 0.05
489 0.05
490 0.05
491 0.05
492 0.05
493 0.05
494 0.05
495 0.05
496 0.04
497 0.04
498 0.04
499 0.04
500 0.04
501 0.04
502 0.03
503 0.03
504 0.03
505 0.03
506 0.03
507 0.03
508 0.03
509 0.03
510 0.03
511 0.03
512 0.03
513 0.03
514 0.03
515 0.04
516 0.04
517 0.04
518 0.04
519 0.04
520 0.05
521 0.05
522 0.06
523 0.06
524 0.06
525 0.06
526 0.07
527 0.07
528 0.09
529 0.09
530 0.1
531 0.13
532 0.13
533 0.14
534 0.14
535 0.13
536 0.13
537 0.13
538 0.12
539 0.09
540 0.09
541 0.09
542 0.08
543 0.08
544 0.06
545 0.06
546 0.05
547 0.07
548 0.09
549 0.09
550 0.09
551 0.14
552 0.15
553 0.22
554 0.27
555 0.29
556 0.36
557 0.46
558 0.56
559 0.62
560 0.72
561 0.75
562 0.79
563 0.8
564 0.8
565 0.8
566 0.78
567 0.77
568 0.75
569 0.7
570 0.64
571 0.63
572 0.56
573 0.49
574 0.41
575 0.35
576 0.29
577 0.25
578 0.23
579 0.2
580 0.17
581 0.14
582 0.14
583 0.11
584 0.08
585 0.07
586 0.07
587 0.08
588 0.15
589 0.25
590 0.34
591 0.41
592 0.49
593 0.54
594 0.58
595 0.66
596 0.68
597 0.68
598 0.67
599 0.67
600 0.69
601 0.75
602 0.79
603 0.8
604 0.78
605 0.76
606 0.77
607 0.8
608 0.82
609 0.81
610 0.76
611 0.75
612 0.79
613 0.78
614 0.76
615 0.72
616 0.67
617 0.66
618 0.68
619 0.62
620 0.61
621 0.64
622 0.65
623 0.7
624 0.74
625 0.76
626 0.8
627 0.87
628 0.89
629 0.89
630 0.87