Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067MJI0

Protein Details
Accession A0A067MJI0    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
33-55SPPPPARHPTPKKPQQRPASFRSHydrophilic
NLS Segment(s)
PositionSequence
21-58HRRSALSHRPPFSPPPPARHPTPKKPQQRPASFRSRAP
Subcellular Location(s) nucl 16, cyto_nucl 10, mito 9
Family & Domain DBs
Amino Acid Sequences MWSHRGPRVSRCLARRYIRTHRRSALSHRPPFSPPPPARHPTPKKPQQRPASFRSRAPPRSLLTAESRIRAHLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.67
3 0.66
4 0.68
5 0.71
6 0.72
7 0.72
8 0.69
9 0.68
10 0.65
11 0.65
12 0.65
13 0.65
14 0.66
15 0.6
16 0.56
17 0.53
18 0.55
19 0.49
20 0.48
21 0.4
22 0.4
23 0.44
24 0.45
25 0.47
26 0.52
27 0.57
28 0.56
29 0.65
30 0.67
31 0.71
32 0.78
33 0.83
34 0.83
35 0.85
36 0.81
37 0.78
38 0.79
39 0.72
40 0.66
41 0.66
42 0.66
43 0.6
44 0.6
45 0.59
46 0.51
47 0.55
48 0.52
49 0.47
50 0.43
51 0.47
52 0.44
53 0.42
54 0.4