Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067M9I9

Protein Details
Accession A0A067M9I9    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
68-87ATPAKSPKQLPSPRPSPRRRHydrophilic
NLS Segment(s)
PositionSequence
74-87PKQLPSPRPSPRRR
Subcellular Location(s) nucl 19.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
Amino Acid Sequences MSMPAAPRFRTIPLPAVEDAEPRRSSRSAAQPASRHSPVRDDRAPPPAPRMRPISLPFEDEGPLTPPATPAKSPKQLPSPRPSPRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.32
3 0.33
4 0.31
5 0.3
6 0.29
7 0.28
8 0.27
9 0.24
10 0.27
11 0.25
12 0.26
13 0.29
14 0.36
15 0.39
16 0.42
17 0.47
18 0.47
19 0.5
20 0.55
21 0.5
22 0.42
23 0.34
24 0.38
25 0.35
26 0.39
27 0.38
28 0.35
29 0.35
30 0.41
31 0.43
32 0.36
33 0.4
34 0.38
35 0.36
36 0.36
37 0.39
38 0.33
39 0.37
40 0.39
41 0.38
42 0.34
43 0.35
44 0.31
45 0.27
46 0.26
47 0.2
48 0.18
49 0.14
50 0.14
51 0.12
52 0.11
53 0.12
54 0.15
55 0.18
56 0.19
57 0.23
58 0.31
59 0.39
60 0.42
61 0.47
62 0.55
63 0.61
64 0.67
65 0.69
66 0.7
67 0.73