Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6QLJ9

Protein Details
Accession B6QLJ9    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
22-43NGKTKAKSKRVGKGGRRWYKDVBasic
NLS Segment(s)
PositionSequence
24-38KTKAKSKRVGKGGRR
Subcellular Location(s) mito 10, nucl 8, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR032440  Ribosomal_S11_N  
IPR000266  Ribosomal_S17/S11  
IPR028333  Ribosomal_S17_arc-typ  
IPR019979  Ribosomal_S17_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG tmf:PMAA_057590  -  
Pfam View protein in Pfam  
PF00366  Ribosomal_S17  
PF16205  Ribosomal_S17_N  
PROSITE View protein in PROSITE  
PS00056  RIBOSOMAL_S17  
Amino Acid Sequences MATELTVQSERAFQKQPHIFANGKTKAKSKRVGKGGRRWYKDVGLGFRTPKNAIEGSYIDKKCPFTGLVSIRGRILTGTVVSTKMHRTLIIRREYLHYVPKYDRYEKRHKNLAAHVSPAFRVEEGDQVTVGQCRPLSKTVRFNVLRVLPRTGKAVKSFAKF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.43
3 0.45
4 0.43
5 0.46
6 0.43
7 0.43
8 0.52
9 0.5
10 0.49
11 0.47
12 0.51
13 0.55
14 0.6
15 0.64
16 0.62
17 0.63
18 0.69
19 0.76
20 0.78
21 0.79
22 0.83
23 0.83
24 0.81
25 0.75
26 0.69
27 0.62
28 0.58
29 0.52
30 0.46
31 0.41
32 0.38
33 0.37
34 0.35
35 0.34
36 0.3
37 0.27
38 0.25
39 0.22
40 0.19
41 0.19
42 0.18
43 0.21
44 0.29
45 0.28
46 0.26
47 0.27
48 0.27
49 0.24
50 0.24
51 0.2
52 0.13
53 0.19
54 0.21
55 0.28
56 0.28
57 0.28
58 0.27
59 0.26
60 0.24
61 0.17
62 0.15
63 0.07
64 0.06
65 0.06
66 0.06
67 0.07
68 0.07
69 0.08
70 0.09
71 0.1
72 0.1
73 0.11
74 0.13
75 0.19
76 0.27
77 0.31
78 0.3
79 0.3
80 0.33
81 0.35
82 0.35
83 0.36
84 0.29
85 0.28
86 0.29
87 0.35
88 0.37
89 0.42
90 0.47
91 0.47
92 0.57
93 0.63
94 0.68
95 0.7
96 0.67
97 0.65
98 0.65
99 0.67
100 0.58
101 0.52
102 0.47
103 0.39
104 0.36
105 0.32
106 0.25
107 0.15
108 0.14
109 0.12
110 0.15
111 0.16
112 0.16
113 0.15
114 0.14
115 0.15
116 0.15
117 0.14
118 0.12
119 0.11
120 0.12
121 0.16
122 0.21
123 0.27
124 0.32
125 0.42
126 0.44
127 0.53
128 0.53
129 0.5
130 0.53
131 0.54
132 0.54
133 0.48
134 0.51
135 0.44
136 0.44
137 0.49
138 0.46
139 0.43
140 0.4
141 0.45