Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067MSM9

Protein Details
Accession A0A067MSM9    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
83-113DVENRKKRGKGAPKKAKTKEDSRRAAKKKRKBasic
NLS Segment(s)
PositionSequence
87-113RKKRGKGAPKKAKTKEDSRRAAKKKRK
Subcellular Location(s) mito 18, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR013219  Ribosomal_S27/S33_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08293  MRP-S33  
Amino Acid Sequences MAAAMVPTRTRLQSLLQLRSSIFATSYNPRSLRTGAKYLRARLRGPSMTQYYPEQLSISRINAVFKKMDIQLIDYEEQQRLEDVENRKKRGKGAPKKAKTKEDSRRAAKKKRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.39
3 0.38
4 0.38
5 0.37
6 0.37
7 0.34
8 0.26
9 0.18
10 0.13
11 0.15
12 0.2
13 0.24
14 0.28
15 0.27
16 0.29
17 0.31
18 0.33
19 0.36
20 0.34
21 0.39
22 0.36
23 0.44
24 0.47
25 0.5
26 0.54
27 0.52
28 0.48
29 0.43
30 0.47
31 0.4
32 0.38
33 0.38
34 0.35
35 0.31
36 0.32
37 0.3
38 0.25
39 0.23
40 0.21
41 0.15
42 0.11
43 0.14
44 0.13
45 0.12
46 0.12
47 0.12
48 0.14
49 0.15
50 0.16
51 0.14
52 0.12
53 0.15
54 0.14
55 0.16
56 0.14
57 0.15
58 0.15
59 0.17
60 0.18
61 0.16
62 0.17
63 0.16
64 0.16
65 0.14
66 0.12
67 0.1
68 0.12
69 0.17
70 0.23
71 0.33
72 0.4
73 0.45
74 0.5
75 0.51
76 0.55
77 0.59
78 0.63
79 0.63
80 0.68
81 0.74
82 0.78
83 0.87
84 0.89
85 0.89
86 0.85
87 0.84
88 0.84
89 0.83
90 0.83
91 0.82
92 0.85
93 0.85