Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067N1P9

Protein Details
Accession A0A067N1P9    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
13-61CMLWTPKPKKLRDAQKVRWTEEEKETEVRKEKKRWNSRGWRKRRDGITIHydrophilic
180-199GRYPGEYHRRRRRSCYHGPGBasic
NLS Segment(s)
PositionSequence
39-56EVRKEKKRWNSRGWRKRR
Subcellular Location(s) mito 18, cyto 6, nucl 2
Family & Domain DBs
Amino Acid Sequences MKHGTEYIICVTCMLWTPKPKKLRDAQKVRWTEEEKETEVRKEKKRWNSRGWRKRRDGITITDPEPYDRPRSPYHRHTGAASPVPRSETPPMTMTLALTTTSTLTSTRTRVMMTTPLDPDPIPKPAAPDGDGVGEGVECESGENGGCVGAGAGKTSTSVISTSTPTAQTLPPCCCPAAVGRYPGEYHRRRRRSCYHGPGADGAAGDAAAEVDVTAVATVTPRSSRAFSATGACTSQPRPSNPPWPAPSETRAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.24
3 0.32
4 0.38
5 0.46
6 0.55
7 0.58
8 0.62
9 0.67
10 0.72
11 0.73
12 0.78
13 0.81
14 0.82
15 0.85
16 0.79
17 0.78
18 0.71
19 0.66
20 0.63
21 0.58
22 0.51
23 0.51
24 0.5
25 0.48
26 0.53
27 0.55
28 0.56
29 0.6
30 0.66
31 0.71
32 0.79
33 0.82
34 0.83
35 0.86
36 0.89
37 0.91
38 0.92
39 0.92
40 0.89
41 0.88
42 0.83
43 0.8
44 0.73
45 0.69
46 0.66
47 0.6
48 0.53
49 0.49
50 0.43
51 0.36
52 0.35
53 0.31
54 0.28
55 0.26
56 0.29
57 0.33
58 0.41
59 0.47
60 0.53
61 0.58
62 0.57
63 0.56
64 0.54
65 0.52
66 0.49
67 0.48
68 0.41
69 0.34
70 0.3
71 0.32
72 0.3
73 0.29
74 0.28
75 0.23
76 0.24
77 0.23
78 0.24
79 0.21
80 0.21
81 0.17
82 0.13
83 0.12
84 0.09
85 0.08
86 0.07
87 0.06
88 0.06
89 0.06
90 0.06
91 0.08
92 0.1
93 0.12
94 0.13
95 0.13
96 0.13
97 0.13
98 0.15
99 0.18
100 0.18
101 0.19
102 0.19
103 0.18
104 0.19
105 0.18
106 0.19
107 0.15
108 0.16
109 0.14
110 0.13
111 0.14
112 0.16
113 0.17
114 0.16
115 0.15
116 0.13
117 0.12
118 0.12
119 0.1
120 0.08
121 0.06
122 0.05
123 0.04
124 0.03
125 0.02
126 0.02
127 0.03
128 0.03
129 0.03
130 0.03
131 0.03
132 0.03
133 0.03
134 0.03
135 0.03
136 0.03
137 0.03
138 0.04
139 0.04
140 0.04
141 0.05
142 0.05
143 0.05
144 0.05
145 0.05
146 0.06
147 0.08
148 0.09
149 0.1
150 0.12
151 0.12
152 0.12
153 0.14
154 0.14
155 0.17
156 0.2
157 0.22
158 0.24
159 0.25
160 0.24
161 0.22
162 0.21
163 0.22
164 0.25
165 0.24
166 0.25
167 0.25
168 0.26
169 0.27
170 0.31
171 0.36
172 0.37
173 0.44
174 0.51
175 0.61
176 0.64
177 0.72
178 0.77
179 0.77
180 0.8
181 0.8
182 0.79
183 0.71
184 0.69
185 0.62
186 0.53
187 0.45
188 0.34
189 0.23
190 0.13
191 0.1
192 0.08
193 0.05
194 0.04
195 0.03
196 0.03
197 0.03
198 0.03
199 0.03
200 0.03
201 0.03
202 0.03
203 0.03
204 0.04
205 0.05
206 0.07
207 0.08
208 0.1
209 0.13
210 0.16
211 0.18
212 0.22
213 0.23
214 0.23
215 0.27
216 0.28
217 0.27
218 0.26
219 0.25
220 0.25
221 0.25
222 0.31
223 0.32
224 0.35
225 0.4
226 0.46
227 0.55
228 0.57
229 0.64
230 0.61
231 0.61
232 0.61
233 0.58