Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067MIC2

Protein Details
Accession A0A067MIC2   
Localization Confidence Low
Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
73-92LKKKQVTIKRIERNKRKHVTBasic
NLS Segment(s)
PositionSequence
60-89KKEAKAAKKATEELKKKQVTIKRIERNKRK
Subcellular Location(s) cyto 17, cyto_nucl 12.333, nucl 5.5, mito_nucl 4.666, mito 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR046447  DENR_C  
IPR005873  DENR_eukaryotes  
IPR001950  SUI1  
IPR036877  SUI1_dom_sf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003743  F:translation initiation factor activity  
Pfam View protein in Pfam  
PF01253  SUI1  
PROSITE View protein in PROSITE  
PS50296  SUI1  
CDD cd11607  DENR_C  
Amino Acid Sequences VCSFPPEFCEFGSHLTRCKEWLSEAHPELFEKYYSEDALAEKVGTLSVEAQSKLEQDTAKKEAKAAKKATEELKKKQVTIKRIERNKRKHVTSIHGLEAFGVDLKKAAKMFAQKFATGASVTKNAQGQEEIVVQGDVADEVEELVGTGELRGVPGENVVRVEEKKGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.33
3 0.33
4 0.31
5 0.33
6 0.29
7 0.25
8 0.3
9 0.29
10 0.35
11 0.36
12 0.37
13 0.35
14 0.35
15 0.34
16 0.29
17 0.25
18 0.17
19 0.17
20 0.16
21 0.16
22 0.15
23 0.14
24 0.13
25 0.14
26 0.13
27 0.1
28 0.08
29 0.08
30 0.07
31 0.06
32 0.06
33 0.06
34 0.08
35 0.1
36 0.1
37 0.11
38 0.11
39 0.12
40 0.12
41 0.14
42 0.13
43 0.13
44 0.18
45 0.22
46 0.25
47 0.24
48 0.26
49 0.31
50 0.36
51 0.42
52 0.41
53 0.41
54 0.41
55 0.45
56 0.49
57 0.52
58 0.5
59 0.48
60 0.54
61 0.49
62 0.47
63 0.5
64 0.48
65 0.45
66 0.49
67 0.53
68 0.53
69 0.6
70 0.69
71 0.73
72 0.77
73 0.8
74 0.78
75 0.71
76 0.68
77 0.64
78 0.61
79 0.58
80 0.52
81 0.45
82 0.38
83 0.36
84 0.29
85 0.24
86 0.18
87 0.12
88 0.08
89 0.05
90 0.05
91 0.06
92 0.08
93 0.08
94 0.08
95 0.1
96 0.19
97 0.21
98 0.29
99 0.31
100 0.29
101 0.29
102 0.29
103 0.28
104 0.2
105 0.18
106 0.12
107 0.14
108 0.14
109 0.16
110 0.18
111 0.17
112 0.18
113 0.18
114 0.16
115 0.14
116 0.15
117 0.13
118 0.11
119 0.1
120 0.09
121 0.08
122 0.08
123 0.06
124 0.04
125 0.04
126 0.04
127 0.04
128 0.04
129 0.04
130 0.04
131 0.04
132 0.04
133 0.04
134 0.04
135 0.05
136 0.05
137 0.06
138 0.06
139 0.07
140 0.07
141 0.11
142 0.13
143 0.13
144 0.14
145 0.16
146 0.2
147 0.2