Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067MAZ1

Protein Details
Accession A0A067MAZ1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
54-75RISNICYPCRRNQRKLIGRANMHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 20, mito 3, plas 2, mito_nucl 2
Family & Domain DBs
Amino Acid Sequences MFLRGCGCLCAVQLGLLCRLLFAFTSIVLQCRLQTGRVNCNLRLPKHLARAEGRISNICYPCRRNQRKLIGRANM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.14
4 0.14
5 0.12
6 0.11
7 0.1
8 0.09
9 0.08
10 0.07
11 0.06
12 0.09
13 0.09
14 0.1
15 0.11
16 0.11
17 0.09
18 0.12
19 0.12
20 0.12
21 0.17
22 0.19
23 0.24
24 0.31
25 0.34
26 0.32
27 0.39
28 0.42
29 0.38
30 0.4
31 0.4
32 0.38
33 0.43
34 0.45
35 0.42
36 0.4
37 0.43
38 0.42
39 0.39
40 0.35
41 0.3
42 0.3
43 0.33
44 0.33
45 0.33
46 0.35
47 0.37
48 0.45
49 0.54
50 0.6
51 0.62
52 0.69
53 0.76
54 0.8
55 0.85