Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067MH96

Protein Details
Accession A0A067MH96    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
4-24PPPAGPSRSKRQRVVSNPTTFHydrophilic
242-262AKSPRLCDRRPRTPSLRPSNRHydrophilic
NLS Segment(s)
PositionSequence
190-219PPPAPAPAKGGKGKKRAPAAAPSKGGSGAP
230-236APKPKKP
Subcellular Location(s) nucl 15.5, cyto_nucl 11, mito 6, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MSNPPPAGPSRSKRQRVVSNPTTFDDDPMSGDVAISGDSRPDTPSEAEPDPIPTTPFRRGPIDWVAEMAAEKLRSNPPGSPAARRKLAWDVPQTPTPRPAQRQPFAPAVPTTATTTDPQIEVDRTARVVSSLIADLTRVAPGGSPSLTPPLRSLINAFFSAIPMDLLAEAIATNVTLMEIVTPHQAPPPPPPAPAPAKGGKGKKRAPAAAPSKGGSGAPVAPSTTPPTSAPKPKKPTFAEAAKSPRLCDRRPRTPSLRPSNR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.78
3 0.79
4 0.82
5 0.8
6 0.78
7 0.73
8 0.68
9 0.66
10 0.56
11 0.48
12 0.41
13 0.32
14 0.25
15 0.23
16 0.21
17 0.14
18 0.14
19 0.12
20 0.09
21 0.09
22 0.08
23 0.07
24 0.07
25 0.08
26 0.09
27 0.1
28 0.11
29 0.13
30 0.15
31 0.18
32 0.22
33 0.23
34 0.23
35 0.23
36 0.25
37 0.25
38 0.23
39 0.21
40 0.19
41 0.22
42 0.27
43 0.31
44 0.3
45 0.33
46 0.33
47 0.37
48 0.41
49 0.4
50 0.34
51 0.3
52 0.27
53 0.23
54 0.22
55 0.17
56 0.12
57 0.09
58 0.09
59 0.12
60 0.15
61 0.17
62 0.19
63 0.19
64 0.21
65 0.29
66 0.3
67 0.36
68 0.4
69 0.44
70 0.46
71 0.45
72 0.44
73 0.43
74 0.47
75 0.44
76 0.44
77 0.43
78 0.42
79 0.48
80 0.47
81 0.41
82 0.4
83 0.38
84 0.37
85 0.38
86 0.43
87 0.46
88 0.47
89 0.5
90 0.5
91 0.5
92 0.44
93 0.41
94 0.33
95 0.25
96 0.23
97 0.19
98 0.16
99 0.12
100 0.13
101 0.12
102 0.13
103 0.12
104 0.11
105 0.11
106 0.11
107 0.11
108 0.1
109 0.11
110 0.1
111 0.1
112 0.09
113 0.08
114 0.07
115 0.07
116 0.06
117 0.06
118 0.06
119 0.06
120 0.05
121 0.05
122 0.06
123 0.06
124 0.05
125 0.04
126 0.04
127 0.04
128 0.05
129 0.06
130 0.06
131 0.06
132 0.07
133 0.13
134 0.13
135 0.13
136 0.13
137 0.15
138 0.15
139 0.15
140 0.17
141 0.14
142 0.16
143 0.16
144 0.16
145 0.13
146 0.13
147 0.13
148 0.11
149 0.08
150 0.05
151 0.05
152 0.04
153 0.04
154 0.03
155 0.03
156 0.03
157 0.03
158 0.03
159 0.03
160 0.03
161 0.02
162 0.02
163 0.02
164 0.02
165 0.03
166 0.03
167 0.04
168 0.07
169 0.07
170 0.08
171 0.11
172 0.13
173 0.15
174 0.2
175 0.27
176 0.26
177 0.27
178 0.28
179 0.32
180 0.35
181 0.37
182 0.37
183 0.34
184 0.38
185 0.44
186 0.51
187 0.53
188 0.57
189 0.6
190 0.61
191 0.64
192 0.63
193 0.6
194 0.62
195 0.61
196 0.59
197 0.56
198 0.5
199 0.44
200 0.39
201 0.35
202 0.25
203 0.2
204 0.15
205 0.13
206 0.13
207 0.13
208 0.13
209 0.15
210 0.19
211 0.18
212 0.18
213 0.19
214 0.25
215 0.32
216 0.42
217 0.5
218 0.55
219 0.64
220 0.68
221 0.76
222 0.74
223 0.74
224 0.72
225 0.71
226 0.66
227 0.65
228 0.66
229 0.65
230 0.61
231 0.55
232 0.56
233 0.54
234 0.53
235 0.56
236 0.58
237 0.61
238 0.67
239 0.75
240 0.74
241 0.78
242 0.83