Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067P0H4

Protein Details
Accession A0A067P0H4   
Localization Confidence Low
Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
246-268QTLRQRSQHGRRHHSPRRVQGSRBasic
NLS Segment(s)
Subcellular Location(s) nucl 10cyto_nucl 10, cyto 8, extr 3, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR011583  Chitinase_II  
IPR029070  Chitinase_insertion_sf  
IPR001223  Glyco_hydro18_cat  
IPR001579  Glyco_hydro_18_chit_AS  
IPR017853  Glycoside_hydrolase_SF  
Gene Ontology GO:0008061  F:chitin binding  
GO:0004568  F:chitinase activity  
GO:0006032  P:chitin catabolic process  
GO:0000272  P:polysaccharide catabolic process  
Pfam View protein in Pfam  
PF00704  Glyco_hydro_18  
PROSITE View protein in PROSITE  
PS01095  GH18_1  
PS51910  GH18_2  
Amino Acid Sequences MGYYPGWAGDSYPPEKIDFDKYDWIDFAFAEPGSDQGLHWDDDQRSTELLKRLTKAAHEKGSKAKLSIGGWSGSRFFSSAVSEEQTRQRLVNTIVQVYHDVELDGVDIDWEYPAKKGETDNEVSATDSANFLAFLKLLRKTLPADAKISAATQSFPFASPEGLPMTNVTEFANELDWIVLMNYDVWGSSADKPGPNAPFLDYCGNSTQPEASALAGFTAWTAAGFPASKIVLGVPSYGYISRSNAQTLRQRSQHGRRHHSPRRVQGSRKVTRDDGLGVVHVASEDGGDQVQFRDLVKQGALVQSGPTSGIAQPNFVGGGGFFRQWDWCSQTPFLVSTQGQGQVISYDDPESLRMKSEFVKQTGMMGVNMFDVHGDNDNLDLTKAIILGLGLDK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.3
3 0.31
4 0.33
5 0.31
6 0.33
7 0.39
8 0.4
9 0.4
10 0.39
11 0.37
12 0.29
13 0.25
14 0.22
15 0.16
16 0.14
17 0.12
18 0.11
19 0.11
20 0.12
21 0.13
22 0.1
23 0.13
24 0.16
25 0.16
26 0.17
27 0.23
28 0.22
29 0.26
30 0.29
31 0.26
32 0.25
33 0.25
34 0.3
35 0.3
36 0.35
37 0.35
38 0.35
39 0.37
40 0.39
41 0.44
42 0.47
43 0.49
44 0.52
45 0.5
46 0.52
47 0.57
48 0.62
49 0.57
50 0.49
51 0.44
52 0.4
53 0.38
54 0.38
55 0.32
56 0.26
57 0.24
58 0.25
59 0.23
60 0.19
61 0.18
62 0.14
63 0.13
64 0.12
65 0.14
66 0.14
67 0.15
68 0.17
69 0.18
70 0.21
71 0.26
72 0.28
73 0.27
74 0.26
75 0.24
76 0.26
77 0.28
78 0.3
79 0.27
80 0.27
81 0.26
82 0.26
83 0.27
84 0.24
85 0.21
86 0.15
87 0.12
88 0.1
89 0.09
90 0.08
91 0.07
92 0.05
93 0.04
94 0.04
95 0.04
96 0.04
97 0.05
98 0.05
99 0.06
100 0.08
101 0.09
102 0.1
103 0.12
104 0.16
105 0.22
106 0.25
107 0.25
108 0.25
109 0.25
110 0.24
111 0.22
112 0.18
113 0.13
114 0.1
115 0.08
116 0.07
117 0.07
118 0.06
119 0.06
120 0.06
121 0.07
122 0.1
123 0.11
124 0.12
125 0.13
126 0.14
127 0.16
128 0.23
129 0.28
130 0.27
131 0.28
132 0.27
133 0.27
134 0.26
135 0.24
136 0.19
137 0.13
138 0.11
139 0.09
140 0.1
141 0.1
142 0.1
143 0.1
144 0.09
145 0.1
146 0.09
147 0.1
148 0.11
149 0.1
150 0.1
151 0.09
152 0.11
153 0.1
154 0.11
155 0.09
156 0.07
157 0.08
158 0.08
159 0.08
160 0.06
161 0.06
162 0.05
163 0.05
164 0.05
165 0.04
166 0.04
167 0.03
168 0.03
169 0.03
170 0.03
171 0.03
172 0.04
173 0.05
174 0.07
175 0.08
176 0.11
177 0.12
178 0.13
179 0.14
180 0.17
181 0.18
182 0.16
183 0.15
184 0.14
185 0.13
186 0.15
187 0.17
188 0.13
189 0.14
190 0.15
191 0.15
192 0.14
193 0.14
194 0.12
195 0.09
196 0.1
197 0.09
198 0.07
199 0.07
200 0.06
201 0.06
202 0.05
203 0.05
204 0.04
205 0.03
206 0.03
207 0.03
208 0.03
209 0.03
210 0.04
211 0.04
212 0.04
213 0.06
214 0.06
215 0.06
216 0.06
217 0.06
218 0.07
219 0.07
220 0.07
221 0.06
222 0.07
223 0.08
224 0.08
225 0.09
226 0.09
227 0.11
228 0.13
229 0.14
230 0.16
231 0.17
232 0.21
233 0.27
234 0.32
235 0.36
236 0.37
237 0.41
238 0.48
239 0.57
240 0.6
241 0.62
242 0.66
243 0.69
244 0.76
245 0.8
246 0.81
247 0.79
248 0.8
249 0.81
250 0.79
251 0.76
252 0.74
253 0.76
254 0.74
255 0.7
256 0.65
257 0.56
258 0.5
259 0.46
260 0.39
261 0.29
262 0.22
263 0.17
264 0.13
265 0.12
266 0.1
267 0.08
268 0.06
269 0.04
270 0.04
271 0.04
272 0.04
273 0.04
274 0.04
275 0.04
276 0.05
277 0.06
278 0.07
279 0.07
280 0.11
281 0.12
282 0.14
283 0.14
284 0.15
285 0.15
286 0.17
287 0.18
288 0.14
289 0.14
290 0.12
291 0.12
292 0.11
293 0.1
294 0.09
295 0.1
296 0.15
297 0.14
298 0.15
299 0.15
300 0.15
301 0.15
302 0.13
303 0.11
304 0.06
305 0.09
306 0.1
307 0.1
308 0.1
309 0.11
310 0.13
311 0.14
312 0.18
313 0.22
314 0.24
315 0.29
316 0.3
317 0.31
318 0.3
319 0.31
320 0.27
321 0.26
322 0.22
323 0.19
324 0.21
325 0.23
326 0.21
327 0.2
328 0.19
329 0.14
330 0.16
331 0.14
332 0.12
333 0.1
334 0.1
335 0.11
336 0.13
337 0.14
338 0.14
339 0.17
340 0.17
341 0.18
342 0.21
343 0.3
344 0.35
345 0.36
346 0.39
347 0.35
348 0.37
349 0.39
350 0.37
351 0.28
352 0.21
353 0.19
354 0.16
355 0.15
356 0.13
357 0.09
358 0.08
359 0.09
360 0.12
361 0.11
362 0.11
363 0.12
364 0.13
365 0.13
366 0.13
367 0.11
368 0.09
369 0.1
370 0.09
371 0.08
372 0.07
373 0.07