Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067NMG9

Protein Details
Accession A0A067NMG9    Localization Confidence Low Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
102-123LVKTKEQQTRDRRPPRGYQVVGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036919  L30_ferredoxin-like_sf  
IPR005996  Ribosomal_L30_bac-type  
IPR016082  Ribosomal_L30_ferredoxin-like  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00327  Ribosomal_L30  
Amino Acid Sequences MQALAFKRLPQLRLAQSHASRSMSSAAQIEPPSTSSSPPTTHFKITLRRSAIGLGDRIKGTLVSLGIHRRHQTVYHPHGPEVAGKLLAVKELIDVENVPTELVKTKEQQTRDRRPPRGYQVVGNRRNEPLIA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.49
3 0.47
4 0.51
5 0.5
6 0.44
7 0.37
8 0.34
9 0.31
10 0.23
11 0.22
12 0.19
13 0.16
14 0.18
15 0.18
16 0.17
17 0.15
18 0.15
19 0.18
20 0.17
21 0.17
22 0.16
23 0.19
24 0.2
25 0.23
26 0.29
27 0.28
28 0.29
29 0.32
30 0.33
31 0.39
32 0.42
33 0.46
34 0.42
35 0.4
36 0.38
37 0.36
38 0.34
39 0.26
40 0.24
41 0.19
42 0.17
43 0.16
44 0.16
45 0.14
46 0.12
47 0.1
48 0.09
49 0.07
50 0.06
51 0.08
52 0.13
53 0.14
54 0.17
55 0.18
56 0.18
57 0.19
58 0.19
59 0.24
60 0.28
61 0.34
62 0.4
63 0.4
64 0.38
65 0.39
66 0.38
67 0.33
68 0.26
69 0.2
70 0.12
71 0.1
72 0.12
73 0.1
74 0.1
75 0.09
76 0.06
77 0.06
78 0.07
79 0.07
80 0.07
81 0.07
82 0.07
83 0.09
84 0.09
85 0.08
86 0.07
87 0.08
88 0.1
89 0.13
90 0.15
91 0.17
92 0.25
93 0.31
94 0.36
95 0.45
96 0.53
97 0.61
98 0.69
99 0.76
100 0.76
101 0.77
102 0.81
103 0.81
104 0.81
105 0.73
106 0.7
107 0.71
108 0.74
109 0.75
110 0.71
111 0.65
112 0.57