Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6QCM7

Protein Details
Accession B6QCM7    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
55-74RPRLSVRRSRDPPKNENNQIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR031514  Zf-C2H2_aberr  
IPR013087  Znf_C2H2_type  
KEGG tmf:PMAA_067790  -  
Pfam View protein in Pfam  
PF17017  zf-C2H2_aberr  
Amino Acid Sequences MSAVMGDGTDYPSPRSEGPTGPSAILIAAPESLSPPTKMTDPLSNLANVSVDGTRPRLSVRRSRDPPKNENNQIFCDHVDCQANPPTFRRPCEWNKHMDKHDRPYKCMEPGCDKIQGFTYSGGLLRHQREVHKKNATTKKALMCPYADCNRSTGNGFTRQENLKEHLRRRHMHTEGGNSPELPVLTVADVEGLKSSFLDPTVGLKRKHDDTTDPELNGVDAIDESSSVDLHNEVKRLRREVEEKDRRLEELEKIVAGLQQSIPHHGLPVVHVPGAEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.24
3 0.25
4 0.26
5 0.29
6 0.33
7 0.33
8 0.3
9 0.29
10 0.24
11 0.2
12 0.17
13 0.13
14 0.08
15 0.07
16 0.07
17 0.07
18 0.08
19 0.1
20 0.11
21 0.12
22 0.13
23 0.14
24 0.16
25 0.2
26 0.22
27 0.27
28 0.29
29 0.31
30 0.31
31 0.3
32 0.29
33 0.26
34 0.22
35 0.15
36 0.13
37 0.1
38 0.1
39 0.11
40 0.13
41 0.14
42 0.14
43 0.18
44 0.22
45 0.28
46 0.35
47 0.42
48 0.51
49 0.57
50 0.66
51 0.72
52 0.74
53 0.78
54 0.79
55 0.81
56 0.78
57 0.78
58 0.73
59 0.67
60 0.61
61 0.53
62 0.43
63 0.35
64 0.27
65 0.23
66 0.23
67 0.19
68 0.2
69 0.26
70 0.27
71 0.27
72 0.29
73 0.34
74 0.35
75 0.38
76 0.38
77 0.39
78 0.46
79 0.55
80 0.56
81 0.56
82 0.61
83 0.66
84 0.69
85 0.71
86 0.68
87 0.68
88 0.72
89 0.65
90 0.59
91 0.59
92 0.56
93 0.52
94 0.49
95 0.42
96 0.41
97 0.43
98 0.43
99 0.41
100 0.37
101 0.31
102 0.31
103 0.29
104 0.23
105 0.19
106 0.17
107 0.11
108 0.13
109 0.12
110 0.11
111 0.14
112 0.15
113 0.18
114 0.19
115 0.24
116 0.33
117 0.37
118 0.43
119 0.46
120 0.47
121 0.53
122 0.61
123 0.59
124 0.53
125 0.53
126 0.5
127 0.48
128 0.48
129 0.39
130 0.31
131 0.29
132 0.31
133 0.32
134 0.28
135 0.23
136 0.22
137 0.22
138 0.22
139 0.21
140 0.18
141 0.16
142 0.23
143 0.24
144 0.24
145 0.27
146 0.28
147 0.29
148 0.29
149 0.3
150 0.3
151 0.36
152 0.41
153 0.45
154 0.51
155 0.52
156 0.58
157 0.63
158 0.57
159 0.57
160 0.53
161 0.52
162 0.48
163 0.48
164 0.4
165 0.31
166 0.28
167 0.23
168 0.2
169 0.13
170 0.09
171 0.06
172 0.06
173 0.06
174 0.05
175 0.06
176 0.06
177 0.05
178 0.06
179 0.06
180 0.05
181 0.06
182 0.06
183 0.06
184 0.06
185 0.07
186 0.07
187 0.12
188 0.21
189 0.27
190 0.27
191 0.3
192 0.34
193 0.38
194 0.41
195 0.38
196 0.35
197 0.37
198 0.45
199 0.46
200 0.42
201 0.38
202 0.34
203 0.31
204 0.26
205 0.18
206 0.09
207 0.05
208 0.05
209 0.04
210 0.04
211 0.05
212 0.05
213 0.05
214 0.05
215 0.06
216 0.06
217 0.11
218 0.13
219 0.17
220 0.19
221 0.27
222 0.33
223 0.37
224 0.39
225 0.43
226 0.47
227 0.52
228 0.62
229 0.65
230 0.63
231 0.65
232 0.63
233 0.57
234 0.54
235 0.48
236 0.41
237 0.38
238 0.35
239 0.28
240 0.27
241 0.27
242 0.24
243 0.21
244 0.19
245 0.13
246 0.16
247 0.17
248 0.22
249 0.23
250 0.21
251 0.22
252 0.21
253 0.2
254 0.19
255 0.25
256 0.23
257 0.21