Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067NBA4

Protein Details
Accession A0A067NBA4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
8-28STTLASRRCRGRRQQLQTAVMHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, cyto 3
Family & Domain DBs
Amino Acid Sequences MPSLYIISTTLASRRCRGRRQQLQTAVMTALIANQATIEADGRHDYESLTHFVIVGAPHNSVSESQSHVTVRGYIDDAPAITIHVKFSRRWNVKEVRTFRGGLALTASDLDFVCDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.44
3 0.52
4 0.62
5 0.69
6 0.74
7 0.8
8 0.84
9 0.83
10 0.8
11 0.72
12 0.63
13 0.51
14 0.4
15 0.31
16 0.21
17 0.12
18 0.08
19 0.07
20 0.05
21 0.04
22 0.04
23 0.04
24 0.05
25 0.05
26 0.04
27 0.06
28 0.07
29 0.08
30 0.09
31 0.08
32 0.08
33 0.09
34 0.11
35 0.12
36 0.11
37 0.1
38 0.09
39 0.09
40 0.1
41 0.09
42 0.09
43 0.08
44 0.07
45 0.07
46 0.08
47 0.08
48 0.07
49 0.08
50 0.08
51 0.09
52 0.1
53 0.11
54 0.12
55 0.12
56 0.12
57 0.13
58 0.12
59 0.1
60 0.11
61 0.1
62 0.1
63 0.1
64 0.09
65 0.08
66 0.08
67 0.07
68 0.07
69 0.07
70 0.09
71 0.13
72 0.15
73 0.17
74 0.25
75 0.35
76 0.41
77 0.44
78 0.51
79 0.56
80 0.62
81 0.7
82 0.67
83 0.62
84 0.59
85 0.57
86 0.48
87 0.46
88 0.38
89 0.28
90 0.26
91 0.2
92 0.17
93 0.17
94 0.16
95 0.1
96 0.1