Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067NVE2

Protein Details
Accession A0A067NVE2    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
157-179AIECHKRRKALKDKLRKIKIREGBasic
NLS Segment(s)
PositionSequence
162-177KRRKALKDKLRKIKIR
Subcellular Location(s) nucl 11.5, cyto_nucl 9, cyto 5.5, extr 5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR015671  GSCR1_dom  
Pfam View protein in Pfam  
PF15249  GLTSCR1  
Amino Acid Sequences MSNLSGSSFVLGSSDLAALKRAQNAHQEPSKAPTEPGTFNSSTTASAGPSSWQTCHRGVEAPAASSRARNGKSWTADELLIIQETKGRFAARLAADHAAVLHPDVDTPFMDVQDAMNRLLPYHIFQQPKNDLEWVINGGKGKQKAAPEAELSETRFAIECHKRRKALKDKLRKIKIREGTRSAPLDQAYALAQAVLDSERTETAWLNAELRTARGELDKIERERRAANPPLPRTSYYNSPTIPSSTLQSQWYRPYPYAYSQPYTTVSTPMNITYTTPVTSAAFATPALTTAAAVTTPATTTTATTTTAAPSPSLPASIAGKSIPVQLPVSSLPALHALGITPVPAASLTAGQALPPAVLRSSAANGTMLNLEINVASLKGAQINGLALILNSLMTRGTSTQPSVTPTATPLSATPANGTTSNG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.1
4 0.12
5 0.14
6 0.17
7 0.22
8 0.24
9 0.26
10 0.36
11 0.4
12 0.47
13 0.5
14 0.5
15 0.46
16 0.49
17 0.49
18 0.4
19 0.36
20 0.35
21 0.34
22 0.34
23 0.35
24 0.37
25 0.34
26 0.33
27 0.35
28 0.29
29 0.24
30 0.23
31 0.2
32 0.14
33 0.14
34 0.14
35 0.13
36 0.17
37 0.18
38 0.19
39 0.22
40 0.27
41 0.28
42 0.31
43 0.31
44 0.31
45 0.3
46 0.37
47 0.34
48 0.31
49 0.29
50 0.29
51 0.28
52 0.24
53 0.27
54 0.27
55 0.27
56 0.29
57 0.33
58 0.38
59 0.43
60 0.45
61 0.44
62 0.38
63 0.36
64 0.33
65 0.29
66 0.21
67 0.17
68 0.14
69 0.11
70 0.11
71 0.11
72 0.13
73 0.13
74 0.13
75 0.12
76 0.13
77 0.21
78 0.19
79 0.21
80 0.22
81 0.22
82 0.21
83 0.21
84 0.2
85 0.13
86 0.11
87 0.09
88 0.07
89 0.06
90 0.06
91 0.06
92 0.07
93 0.07
94 0.1
95 0.1
96 0.1
97 0.1
98 0.1
99 0.1
100 0.14
101 0.15
102 0.13
103 0.16
104 0.15
105 0.15
106 0.16
107 0.16
108 0.14
109 0.18
110 0.24
111 0.24
112 0.25
113 0.33
114 0.38
115 0.39
116 0.38
117 0.33
118 0.27
119 0.25
120 0.26
121 0.21
122 0.16
123 0.16
124 0.15
125 0.15
126 0.19
127 0.2
128 0.2
129 0.2
130 0.21
131 0.25
132 0.28
133 0.28
134 0.25
135 0.25
136 0.27
137 0.25
138 0.24
139 0.2
140 0.17
141 0.15
142 0.13
143 0.12
144 0.18
145 0.25
146 0.31
147 0.39
148 0.45
149 0.5
150 0.54
151 0.64
152 0.67
153 0.69
154 0.72
155 0.75
156 0.79
157 0.84
158 0.89
159 0.85
160 0.8
161 0.79
162 0.77
163 0.74
164 0.71
165 0.66
166 0.6
167 0.59
168 0.56
169 0.47
170 0.41
171 0.33
172 0.26
173 0.2
174 0.17
175 0.11
176 0.09
177 0.08
178 0.05
179 0.05
180 0.04
181 0.05
182 0.04
183 0.04
184 0.04
185 0.04
186 0.05
187 0.05
188 0.06
189 0.06
190 0.06
191 0.09
192 0.09
193 0.1
194 0.1
195 0.11
196 0.1
197 0.11
198 0.11
199 0.08
200 0.08
201 0.08
202 0.09
203 0.09
204 0.14
205 0.18
206 0.2
207 0.24
208 0.25
209 0.26
210 0.28
211 0.3
212 0.32
213 0.33
214 0.36
215 0.39
216 0.42
217 0.45
218 0.45
219 0.43
220 0.4
221 0.37
222 0.39
223 0.34
224 0.34
225 0.3
226 0.29
227 0.28
228 0.25
229 0.24
230 0.17
231 0.17
232 0.15
233 0.16
234 0.18
235 0.2
236 0.21
237 0.24
238 0.28
239 0.28
240 0.27
241 0.28
242 0.28
243 0.29
244 0.34
245 0.32
246 0.31
247 0.28
248 0.3
249 0.29
250 0.29
251 0.27
252 0.22
253 0.19
254 0.17
255 0.17
256 0.16
257 0.15
258 0.12
259 0.12
260 0.11
261 0.12
262 0.12
263 0.11
264 0.11
265 0.11
266 0.11
267 0.11
268 0.09
269 0.08
270 0.07
271 0.08
272 0.07
273 0.07
274 0.07
275 0.06
276 0.06
277 0.06
278 0.06
279 0.05
280 0.05
281 0.05
282 0.05
283 0.05
284 0.05
285 0.06
286 0.06
287 0.07
288 0.09
289 0.1
290 0.11
291 0.12
292 0.12
293 0.13
294 0.14
295 0.14
296 0.13
297 0.12
298 0.14
299 0.13
300 0.13
301 0.11
302 0.11
303 0.14
304 0.14
305 0.14
306 0.11
307 0.12
308 0.12
309 0.17
310 0.16
311 0.16
312 0.16
313 0.16
314 0.18
315 0.18
316 0.2
317 0.15
318 0.14
319 0.12
320 0.13
321 0.13
322 0.11
323 0.1
324 0.07
325 0.09
326 0.09
327 0.08
328 0.06
329 0.05
330 0.06
331 0.06
332 0.06
333 0.05
334 0.06
335 0.06
336 0.09
337 0.09
338 0.08
339 0.1
340 0.1
341 0.09
342 0.09
343 0.1
344 0.08
345 0.08
346 0.09
347 0.1
348 0.13
349 0.14
350 0.14
351 0.13
352 0.13
353 0.14
354 0.14
355 0.12
356 0.09
357 0.08
358 0.08
359 0.07
360 0.08
361 0.07
362 0.06
363 0.06
364 0.06
365 0.07
366 0.09
367 0.09
368 0.09
369 0.09
370 0.1
371 0.1
372 0.09
373 0.09
374 0.06
375 0.07
376 0.06
377 0.06
378 0.05
379 0.05
380 0.05
381 0.05
382 0.08
383 0.09
384 0.13
385 0.17
386 0.2
387 0.23
388 0.25
389 0.29
390 0.3
391 0.29
392 0.26
393 0.25
394 0.26
395 0.23
396 0.22
397 0.18
398 0.22
399 0.23
400 0.23
401 0.23
402 0.22
403 0.24