Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6QAW8

Protein Details
Accession B6QAW8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MGQRHNRRRTRPRSRNRAASLDSHydrophilic
NLS Segment(s)
PositionSequence
7-15RRRTRPRSR
Subcellular Location(s) mito 25
Family & Domain DBs
KEGG tmf:PMAA_074190  -  
Amino Acid Sequences MGQRHNRRRTRPRSRNRAASLDSVLSSSFTFDFAARSPVSQHSELAVLAPLAHTRHNWLEEWQSYEMNEWFDADQLAIQQQYRYFGGEPGDDENLKEEEDKKIQVGREPSSVPAASYASLHMPLALGMSLGPTGQRVYRHELTLRGVIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.93
3 0.88
4 0.85
5 0.77
6 0.71
7 0.63
8 0.54
9 0.44
10 0.34
11 0.28
12 0.21
13 0.17
14 0.13
15 0.1
16 0.09
17 0.09
18 0.09
19 0.1
20 0.1
21 0.14
22 0.12
23 0.13
24 0.14
25 0.18
26 0.23
27 0.22
28 0.22
29 0.19
30 0.19
31 0.19
32 0.17
33 0.12
34 0.07
35 0.07
36 0.06
37 0.07
38 0.07
39 0.08
40 0.08
41 0.11
42 0.13
43 0.15
44 0.16
45 0.16
46 0.2
47 0.2
48 0.24
49 0.22
50 0.19
51 0.18
52 0.19
53 0.18
54 0.14
55 0.12
56 0.09
57 0.08
58 0.08
59 0.08
60 0.06
61 0.05
62 0.04
63 0.05
64 0.05
65 0.05
66 0.05
67 0.06
68 0.08
69 0.08
70 0.1
71 0.09
72 0.11
73 0.12
74 0.11
75 0.12
76 0.12
77 0.14
78 0.12
79 0.12
80 0.12
81 0.12
82 0.12
83 0.12
84 0.11
85 0.13
86 0.16
87 0.16
88 0.16
89 0.19
90 0.2
91 0.23
92 0.27
93 0.26
94 0.27
95 0.27
96 0.27
97 0.27
98 0.27
99 0.22
100 0.19
101 0.17
102 0.13
103 0.13
104 0.13
105 0.1
106 0.11
107 0.1
108 0.09
109 0.08
110 0.08
111 0.08
112 0.07
113 0.05
114 0.04
115 0.05
116 0.05
117 0.05
118 0.05
119 0.05
120 0.07
121 0.1
122 0.14
123 0.18
124 0.26
125 0.31
126 0.35
127 0.37
128 0.39
129 0.41