Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067P6F1

Protein Details
Accession A0A067P6F1    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
3-22IPVPNLTKKSRGRRVPTVAVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 3, cyto 3, plas 3, cyto_nucl 3, E.R. 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Pfam View protein in Pfam  
PF00096  zf-C2H2  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences VPIPVPNLTKKSRGRRVPTVAVLQRGRSSDRTRGGSSMSDGAAAGSKTSASRMYTCTADGCGKCFARGEHLKRHVRSIHTYEKRTCKPVIRLLFLLWLPLLIEVVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.76
3 0.8
4 0.79
5 0.74
6 0.73
7 0.67
8 0.65
9 0.58
10 0.5
11 0.45
12 0.39
13 0.37
14 0.34
15 0.35
16 0.35
17 0.39
18 0.42
19 0.41
20 0.4
21 0.38
22 0.33
23 0.3
24 0.25
25 0.18
26 0.13
27 0.12
28 0.11
29 0.1
30 0.09
31 0.07
32 0.05
33 0.05
34 0.05
35 0.06
36 0.08
37 0.08
38 0.09
39 0.11
40 0.13
41 0.13
42 0.14
43 0.13
44 0.13
45 0.16
46 0.15
47 0.15
48 0.18
49 0.17
50 0.17
51 0.18
52 0.16
53 0.21
54 0.3
55 0.32
56 0.38
57 0.47
58 0.55
59 0.55
60 0.61
61 0.57
62 0.53
63 0.55
64 0.52
65 0.54
66 0.54
67 0.59
68 0.6
69 0.65
70 0.65
71 0.63
72 0.61
73 0.58
74 0.57
75 0.61
76 0.61
77 0.57
78 0.54
79 0.5
80 0.51
81 0.43
82 0.36
83 0.27
84 0.19
85 0.14
86 0.13