Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067NSM4

Protein Details
Accession A0A067NSM4   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
121-156IEDTEQPPKKKRRRQALSCTECKRRKIKCDRFGITFHydrophilic
NLS Segment(s)
PositionSequence
129-134KKKRRR
Subcellular Location(s) nucl 20, cyto_nucl 12, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
CDD cd00067  GAL4  
Amino Acid Sequences MHSSPPQQPAAPRSAASRTQPQHRRTPSLTDPSPQNTTLPSIRQLQLPPPGIAQPHPGQSAEHLASYTYPAPPHFVHHHPSSSSTTTISAPSAPQAPPPPPPQHLGRDRDVDVYTMAESDIEDTEQPPKKKRRRQALSCTECKRRKIKCDRFGITFYGVLDILTNVSLFSPPTSTCIKYTH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.39
3 0.39
4 0.44
5 0.44
6 0.52
7 0.6
8 0.61
9 0.66
10 0.67
11 0.7
12 0.63
13 0.66
14 0.64
15 0.65
16 0.61
17 0.55
18 0.54
19 0.51
20 0.51
21 0.43
22 0.36
23 0.28
24 0.3
25 0.28
26 0.26
27 0.24
28 0.26
29 0.26
30 0.29
31 0.29
32 0.3
33 0.34
34 0.35
35 0.32
36 0.28
37 0.28
38 0.26
39 0.25
40 0.26
41 0.2
42 0.2
43 0.21
44 0.2
45 0.19
46 0.19
47 0.23
48 0.19
49 0.17
50 0.13
51 0.12
52 0.12
53 0.14
54 0.14
55 0.09
56 0.09
57 0.09
58 0.13
59 0.13
60 0.18
61 0.2
62 0.22
63 0.25
64 0.27
65 0.29
66 0.26
67 0.28
68 0.28
69 0.24
70 0.22
71 0.18
72 0.17
73 0.16
74 0.16
75 0.13
76 0.1
77 0.08
78 0.09
79 0.1
80 0.09
81 0.11
82 0.12
83 0.14
84 0.17
85 0.22
86 0.25
87 0.24
88 0.28
89 0.29
90 0.35
91 0.41
92 0.41
93 0.39
94 0.4
95 0.39
96 0.39
97 0.35
98 0.28
99 0.21
100 0.17
101 0.13
102 0.1
103 0.09
104 0.06
105 0.05
106 0.06
107 0.06
108 0.05
109 0.06
110 0.06
111 0.14
112 0.2
113 0.23
114 0.3
115 0.41
116 0.5
117 0.6
118 0.69
119 0.73
120 0.77
121 0.85
122 0.88
123 0.89
124 0.87
125 0.87
126 0.85
127 0.84
128 0.79
129 0.76
130 0.74
131 0.71
132 0.73
133 0.76
134 0.8
135 0.79
136 0.83
137 0.81
138 0.77
139 0.72
140 0.65
141 0.56
142 0.46
143 0.37
144 0.28
145 0.23
146 0.17
147 0.14
148 0.11
149 0.09
150 0.08
151 0.07
152 0.05
153 0.06
154 0.07
155 0.07
156 0.08
157 0.1
158 0.1
159 0.14
160 0.18
161 0.2