Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067PB32

Protein Details
Accession A0A067PB32    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
53-80GPGGKAERVQRRRENKQRIKDQNFMKTQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, cyto 7, nucl 3, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences KSPAPAKSSCIPNTVIDGVNYLKGQEPVIAKPDDEYPAWLWTILAPKVYPDDGPGGKAERVQRRRENKQRIKDQNFMKTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.29
3 0.21
4 0.21
5 0.19
6 0.19
7 0.17
8 0.13
9 0.12
10 0.12
11 0.12
12 0.14
13 0.15
14 0.14
15 0.18
16 0.18
17 0.16
18 0.17
19 0.18
20 0.17
21 0.15
22 0.15
23 0.13
24 0.13
25 0.13
26 0.12
27 0.1
28 0.09
29 0.13
30 0.11
31 0.1
32 0.09
33 0.1
34 0.11
35 0.12
36 0.11
37 0.09
38 0.13
39 0.13
40 0.14
41 0.15
42 0.16
43 0.16
44 0.2
45 0.26
46 0.32
47 0.38
48 0.46
49 0.54
50 0.61
51 0.72
52 0.79
53 0.83
54 0.83
55 0.87
56 0.9
57 0.91
58 0.89
59 0.87
60 0.84