Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A067NE31

Protein Details
Accession A0A067NE31    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
71-91ANPSGDKKKAKKTKTPPAAAAHydrophilic
NLS Segment(s)
PositionSequence
77-84KKKAKKTK
Subcellular Location(s) mito 9, nucl 6.5, cyto_nucl 6.5, cyto 5.5, plas 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MRYAKAAYIVQHSTTTTYPACLEDRKNVRDFKSLSSDGAEGSRQEALHRQPPITMRVALFVLAFAAVFVLANPSGDKKKAKKTKTPPAAAAAEEPAPVDGGDAPAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.24
3 0.18
4 0.17
5 0.16
6 0.17
7 0.2
8 0.21
9 0.23
10 0.29
11 0.36
12 0.39
13 0.44
14 0.46
15 0.46
16 0.49
17 0.48
18 0.44
19 0.44
20 0.4
21 0.35
22 0.33
23 0.3
24 0.23
25 0.22
26 0.18
27 0.1
28 0.1
29 0.11
30 0.09
31 0.09
32 0.13
33 0.15
34 0.2
35 0.21
36 0.2
37 0.21
38 0.23
39 0.25
40 0.23
41 0.21
42 0.15
43 0.15
44 0.15
45 0.14
46 0.12
47 0.08
48 0.06
49 0.05
50 0.05
51 0.03
52 0.03
53 0.02
54 0.02
55 0.02
56 0.04
57 0.04
58 0.04
59 0.05
60 0.08
61 0.1
62 0.14
63 0.21
64 0.26
65 0.37
66 0.46
67 0.53
68 0.61
69 0.69
70 0.77
71 0.81
72 0.81
73 0.74
74 0.71
75 0.66
76 0.56
77 0.48
78 0.39
79 0.3
80 0.23
81 0.2
82 0.14
83 0.12
84 0.1
85 0.09
86 0.07