Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A067PAV2

Protein Details
Accession A0A067PAV2    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
84-111ARGAEYQPSQRKRKRKHGFLARKRSVSGHydrophilic
NLS Segment(s)
PositionSequence
93-124QRKRKRKHGFLARKRSVSGRKVLARRLAKGRK
Subcellular Location(s) mito 16, nucl 8, cyto 1, plas 1, pero 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MPRLPPSLTRLLSRPPSLQTVSSTLRPFAAASAMQVSNTITKLPFITHPFLKSANPSFLASAWRTTSLQPPTILWSVVQARFGARGAEYQPSQRKRKRKHGFLARKRSVSGRKVLARRLAKGRKYLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.38
3 0.41
4 0.41
5 0.39
6 0.34
7 0.33
8 0.33
9 0.35
10 0.33
11 0.28
12 0.27
13 0.25
14 0.22
15 0.17
16 0.16
17 0.1
18 0.1
19 0.14
20 0.13
21 0.12
22 0.13
23 0.13
24 0.12
25 0.12
26 0.12
27 0.08
28 0.08
29 0.09
30 0.1
31 0.14
32 0.16
33 0.2
34 0.21
35 0.22
36 0.23
37 0.24
38 0.23
39 0.23
40 0.22
41 0.2
42 0.2
43 0.19
44 0.18
45 0.17
46 0.19
47 0.16
48 0.15
49 0.13
50 0.13
51 0.13
52 0.14
53 0.19
54 0.18
55 0.2
56 0.19
57 0.18
58 0.21
59 0.21
60 0.2
61 0.14
62 0.15
63 0.17
64 0.17
65 0.17
66 0.14
67 0.13
68 0.14
69 0.15
70 0.12
71 0.08
72 0.09
73 0.1
74 0.14
75 0.15
76 0.21
77 0.29
78 0.36
79 0.46
80 0.52
81 0.61
82 0.66
83 0.77
84 0.81
85 0.82
86 0.85
87 0.87
88 0.91
89 0.92
90 0.93
91 0.9
92 0.82
93 0.74
94 0.71
95 0.69
96 0.63
97 0.6
98 0.57
99 0.58
100 0.61
101 0.65
102 0.66
103 0.63
104 0.64
105 0.67
106 0.68
107 0.65
108 0.69